KEGG   Jatropha curcas (Barbados nut): 105650891
Entry
105650891         CDS       T03922                                 
Name
(RefSeq) LOW QUALITY PROTEIN: bifunctional desaturase/conjugase FADX
  KO
K21736  Delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase [EC:1.14.19.33 1.14.19.34]
Organism
jcu  Jatropha curcas (Barbados nut)
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105650891
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.33  Delta12 acyl-lipid conjugase (11E,13E-forming)
     105650891
    1.14.19.34  acyl-lipid (9+3)-(E)-desaturase
     105650891
SSDB
Motif
Pfam: FA_desaturase DUF3474
Other DBs
NCBI-GeneID: 105650891
NCBI-ProteinID: XP_012093240
UniProt: G9I194
Position
Unknown
AA seq 387 aa
MGAGGQKTAVLVSSKFKEMETNRRLXQVPHTKHPFTLGEIKQAIPSHCCKRSLLRSFSYL
VYDLSLSSFFYSIAASYFHLFPSPISYIAWPIYWTLQGCTLTGVWVIAHECGHHAFSDYQ
WVDDTVGLILHSSLLVPYFSWKISHRRHHYNTGSIERGEVFVPKFKSRIPWYSQNLNNPL
GRXLALAATLTVGWPLYLAFSVSGRPYDRFACHFDPYGPIYFDRERLQIYISDIGIFAAX
YVLYQIAMAKGLAWLVSIYGIPLLIVNAFLVTITYLQHTHPALPHYDSSEWDWLRGALST
VDRDYGVLNKVFHNITDTHVTHHLFSTMPHYHAMEATKAIKPILGEYYQFDGTPILMALW
REAKECLFFEPEEGGPNRGVLWYGNKY
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgggagccggtggccaaaaaactgctgtccttgtcagcagtaagttcaaggaaatggaa
accaacagacgcctgtagcaggttccacacacaaaacatccattcactcttggcgaaatc
aaacaagccatcccatcccattgctgtaaacgctcccttctccgctctttctcctacctt
gtttatgacctctctttaagctctttcttctactccattgctgctagctacttccatctt
tttccttctccgatctcctacattgcttggcccatctactggactctccagggctgcact
ctcactggtgtttgggtcattgctcatgaatgcggccaccatgcttttagtgactatcaa
tgggttgatgacactgttggcctaattctccactcttcacttcttgttccttatttttca
tggaaaattagccatcgtcgccatcactacaacaccggttccattgaacgtggtgaggtg
tttgtccccaaattcaagtctagaatcccttggtattcccagaacctcaataacccacta
ggtcgangcttagccctcgcagccacactcacggtcggctggccgttgtacttagccttc
agtgtgtctggacgaccttatgatcggtttgcttgtcattttgatccttatggaccaata
tattttgatagagaaaggcttcagatttacatttctgacattgggattttcgctgcancc
tatgtgctctatcagattgccatggcaaaagggttagcttggctggtatctatttatggg
ataccattgcttattgttaatgcttttcttgtgacaatcacatatttgcagcacactcac
cctgcattgccacactatgactcgtccgaatgggattggctccggggagctttgtcgaca
gtggatagagattatggggtgttgaataaggttttccataatattacagacactcatgta
acccaccatctcttctctacaatgcctcattatcatgcaatggaggccactaaagcaatc
aagcctatattgggcgagtattatcagtttgatggcactccgattcttatggcgctctgg
agggaggccaaagagtgcctgtttttcgagccagaagagggaggtcccaaccgaggcgtt
ctctggtatggaaataagtattga

DBGET integrated database retrieval system