KEGG   Janthinobacterium lividum: G3257_17685
Entry
G3257_17685       CDS       T06723                                 

Symbol
vioC
Name
(GenBank) FAD-dependent monooxygenase VioC
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
jlv  Janthinobacterium lividum
Pathway
jlv00404  Staurosporine biosynthesis
jlv01100  Metabolic pathways
jlv01110  Biosynthesis of secondary metabolites
jlv02024  Quorum sensing
Module
jlv_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:jlv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    G3257_17685 (vioC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G3257_17685 (vioC)
Enzymes [BR:jlv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     G3257_17685 (vioC)
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 DAO NAD_binding_8 SE FAD_binding_2 Pyr_redox GIDA HI0933_like FAD_oxidored ApbA 3HCDH_N UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: QKY03905
UniProt: A1X1N5
Position
3960697..3961986
AA seq 429 aa
MHKIIIVGGGLAGSLSAIYLAQRGHDVHVVEKRGDPLLENAANADPVNSRAIGVSMTVRG
IKAVLAAGISKQELDQCGEPIVGMAFSVGGRHRIRELTPLEGLFPLSLDRTAFQRLLNRH
AALHEVKYYFEHKCLDVDLERKIVLIQGPDGALQKLHGDLVIGADGAHSAVRRAMQSGMR
RFEFRQSYFRHGYKTLVLPNAADLGFRKDLLYFFGMDSKGLFAGRAATIPDGSISFALCL
PYTGTPSLGTLNREAMADFFSRYFGTLPPDRRKEMLDQFMALPSNDLINVRSSTFHYKAN
ILLIGDAAHATAPFLGQGMNMALEDVHVFVSLLEKHGNALGPALSEFTQQRKVQADAMQD
MAIANYEALSNPNLIFFLQTRYTRYMHKKFPRVYPPDMAEKLYFTSVPYDELQQIQKKQN
VWYKLGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcataaaatcattatcgtcggcggaggcctggcaggcagcctcagcgccatttatctg
gcgcaacgggggcacgatgtccacgttgtcgaaaagcgcggtgatccgctgctggagaat
gccgccaacgccgaccccgtcaactcgcgcgccatcggcgtaagcatgacggtacgcggc
atcaaggccgtcctggccgccggcatcagcaagcaggagctcgaccagtgcggcgaaccc
atcgtcggcatggcattcagcgtgggcggccggcaccggatacgcgagctgaccccgctc
gaaggcctgttccccctgtcgctggaccgcaccgccttccagcgcctgctgaaccggcat
gccgccctgcacgaggtgaagtattactttgagcataaatgcctggatgtcgacctggaa
agaaagatcgtgctgatccagggcccggacggcgccttgcagaagctgcatggcgacctg
gtcattggcgccgacggcgcccactctgccgttcggcgcgccatgcaaagcggcatgcgc
cgtttcgagttcaggcagagttacttccgccacggctacaagacgctggtgttgccgaac
gcggcggatctgggtttcagaaaggatttgctgtacttcttcggcatggattccaagggc
ctgtttgccggccgcgcggccaccatcccggacggcagcatcagctttgccctgtgcctg
ccctacaccggcacgcccagcctgggcacgctcaaccgcgaagccatggccgatttcttc
agccgctacttcggcaccctgccgccggaccgtcgcaaggaaatgctggaccagttcatg
gcgctgcccagcaacgatctcatcaatgtccgttccagcaccttccactacaaggccaat
atcctgctgatcggcgatgcggcgcatgccaccgccccgttcctcggacaaggcatgaac
atggcgctggaagacgtccacgtcttcgtttccctgctggaaaagcacggcaatgccctg
ggccctgccctgtccgaattcacgcagcagcgcaaggtgcaggcggacgccatgcaggac
atggcgatcgccaactatgaggcgctgagcaatccgaatctgattttcttcctgcagacg
cgctacacgcgctacatgcataagaaattcccccgtgtttatccgccagacatggcggag
aaactgtacttcacatcggttccttacgatgaattgcagcaaatccagaagaaacaaaac
gtttggtacaaacttggaagggtaaattaa

DBGET integrated database retrieval system