KEGG   Kazachstania africana: KAFR_0E03830
Entry
KAFR_0E03830      CDS       T02487                                 

Symbol
KAFR0E03830
Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
kaf  Kazachstania africana
Pathway
kaf03440  Homologous recombination
kaf03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KAFR_0E03830 (KAFR0E03830)
   03450 Non-homologous end-joining
    KAFR_0E03830 (KAFR0E03830)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kaf03400]
    KAFR_0E03830 (KAFR0E03830)
DNA repair and recombination proteins [BR:kaf03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     KAFR_0E03830 (KAFR0E03830)
   NHEJ (non-homologous end-joining)
    MRX complex
     KAFR_0E03830 (KAFR0E03830)
SSDB
Motif
Pfam: FHA Phage_Orf51
Other DBs
NCBI-GeneID: 13883350
NCBI-ProteinID: XP_003957669
UniProt: H2AVY4
Position
5:759871..762408
AA seq 845 aa
MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE
GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL
SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLLS
EVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISHDD
LLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKIYAIK
EIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNTNTHA
TISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFAGGSTNPSTTLKTV
SPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQSLSSQPTTNRSIQ
NKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLIQPIDSNSNVSQETNVPKESME
DNDNSSNTLSEVNRNILSRKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTK
IVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQ
HRDGYDSLRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAV
SEDDILLNEMRTKAIGLTDNGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSEDELQEER
LEKGFGSNRNSNHSFVKEGSTSGILNDFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFK
FRRNR
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgtggattttaagatacgagaatgagttagaagatggtactttaaggaaagtatcttgc
tgtttgcagaaatggaaaatgtacagtataggcaggtcaagtaaaaatccactaacgata
aaaaacgacaagagtatatcccgtcagcatataacaatacgatgggactgtaataatgaa
ggaactgggactgtcctaagtgtggtaaatcaaggtaaattgactgcaattgacgaaaat
tatatgaaaagtgatgaatccaaagcttttgacgatgagacatactccacagtggtagtc
aaactagggacgaagcctgttgtagtcagaattagctggacgcccatattctgggatttg
tcgaaagatttcttacaatttgaaaaaagcataaacagcatgggtatttgtacccaaatg
caatctagcaatgtcagagatataagtttagtcataaatgatgaaaaaagtaactggagt
aggatcatgtttgcattattgaagcaaaattgtacattggtgaaaccagtactactttct
gaagtctgcaacgtcttgctggctgactgtcagactaattttgatgagatatgggctcaa
ttgttcgaatcattcagtaattatactgtatatccaggttttactgtagaaggtaatgat
atactgagagcgtttcaagatgttcaattttatacagtggggagcatatctcatgacgat
ttactttatctgaaagcaactgtttcagaactacaaggaaactttaaaagttttgatacg
gccgacgatttagttacctatattaaaactgttaaccacaacttattgaaatgtatagct
ctgaagcaagaagatccagcgcctgatgaaattcaaggcattaaaatatatgctattaaa
gagatagtacaagctatactcgatggaaacttcaaaaatctacctactcacattggacga
tctaatacttccagaaagaggaacttcacggactcgatttctcactataatgaagatgct
caacgaaactcacacgtgcatcctgataatactagcacactaaacacaaacacacatgca
actataagcgctgcagcggaagcatcaagagaaggtggtgaaagtcttgagcccccaaca
gttatgggtccaagtccaactaagagaagaagattggttaggcgaacagtgaaaccgttg
gatagtttgagtttttttgctggcgggtccactaatcccagtacaacattgaaaactgta
agtcctgtcgttccttcgaatgcttcaaacactacttcagatgaaaagccgaataaagta
gagagtaagctaggtgtgaacaatgctcgaagagatgagcaaaccaatgatcaagtcgat
gtagtccagaccgcattacagtctttatcatctcagcctactaccaaccgctcgatccag
aacaaaggtatcttacgtacagagaataacgatgaaatgcttacgaatgccagtataaaa
aggcgtaatatgccgctcaaaccattgtcgccagacgtagatacaaatttgctcattcaa
cctattgattcaaactcaaatgtctctcaagaaactaacgtacctaaagaaagcatggag
gataacgataattcctccaatacattgtctgaagtgaacagaaatatcctttctaggaaa
agcgaaagtggcccccataagttcgacgtatctcttacaaaacgcagtaaatctcctgct
gctttcattgaagctgttcaatcaacgaaaactagggaggtaaaacgtatacgaacaaaa
attgtagacgtatcgccatcagaactatcagaagaggccattaacaagttatcgaaccta
acaatagttgaaagcaatccgaacctaatacgtgaaagaagagccgataaaaatgatagc
gtcaacgatatgtggaaaggccggaggaattttaaaaagtttaataaagtatggccccag
catagggacggttatgattcattaagaaataatgctttcttgattattagaaattatgtc
gaattaaagccttacgatggtaaacgcaatgataatgatagcagtgatttccacgaagga
cggtcgcattttaatgacgaaaatgattatgaagtcatacgtagaggaaatcctgcagtg
agcgaagatgatattctattgaacgaaatgaggacaaaagccattggtttgacagataat
ggaaatgatgaagatttcacgcgcattgctaactctgatcaggctgttccaacggtacac
ggagtttctagattatttgtggcagatgatgacagtgaggatgaacttcaggaagaacgg
cttgaaaagggatttggatcaaacagaaattcgaaccattcgtttgttaaagaaggctct
acttcaggaattcttaacgatttttctaaagatactgttttaagatctcacttaggtagg
aaaaaagcatttacccaaatagatagtggtgatgaggacgatgacggaccaaagttcaag
ttcagaaggaatcgttag

DBGET integrated database retrieval system