KEGG   Kribbella flavida: Kfla_1896
Entry
Kfla_1896         CDS       T01155                                 

Name
(GenBank) glycoside hydrolase 15-related protein
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
kfl  Kribbella flavida
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Kfla_1896
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     Kfla_1896
SSDB
Motif
Pfam: Glyco_hydro_15 TPR_4
Other DBs
NCBI-ProteinID: ADB30990
UniProt: D2PPM8
Structure
Position
complement(1996326..1997483)
AA seq 385 aa
MTTSARDTGLDSHELARLHELARHSHAVITRHQDAGGAYPAAPTFSAYRGYAWLRDGSFT
AEGISRYGDVASAGRFHDWVDGVLRRRRGQVDDLLAAVDRGEVPSNEGMLPTRFTFDGND
GSDPWWDFQTDGYGMWLWSVVTHAARHGLDLERWRAGIDVAVDYLLAFWDRPCYDWWEEH
VEHRHVSTLGAIHGGLVAVGTCAALRSAPWSAATLQVAARIRSLVSAEGVVDGHLVKWLG
SSAVDGSLPACVVPFGLVPPDDDVAAMTRAAVAKDLDVDGGVHRFAADVFYGGGQWILLS
ALLGWNLAAAGDTAGALRHLRWIADQADADGDLPEQVPHHLLHPGSRAEWVARWGTVATP
LLWSHGMYLILADELGLLPPAAKDA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaccacctccgcccgggacaccggcctcgacagccacgagctcgcccgtctgcacgag
ctcgcccggcacagtcacgccgtcatcacccgtcaccaggacgccggcggggcgtatccc
gccgcaccgaccttctcggcgtaccggggctatgcctggctgcgggacggctcgttcacc
gccgaaggcatttcccggtacggcgacgtggcgtccgccgggcggttccacgactgggtg
gacggcgtactgcgcagacgccgcgggcaggtcgacgacctgctcgcggcggtcgaccgg
ggcgaggtcccgtcgaacgagggcatgctgccgacccggttcaccttcgacggcaacgac
gggtcggacccgtggtgggacttccagaccgacggctacggcatgtggctgtggtcggtg
gtcacccacgcggcgcggcacgggctggacctggagcgctggcgggccggtatcgacgtc
gccgtcgactacctgctcgccttctgggaccggccttgctacgactggtgggaggagcac
gtcgagcatcggcacgtgtccacgctcggcgcgatccacggcggactggtcgcggtcggt
acctgcgcggccttgcggtcggcgccctggtcggcggcgacgctgcaggtggcggcccgg
atccgctcgctggtgagcgccgagggcgttgtcgacgggcacctggtgaagtggctcggc
agctcggccgtcgacgggtcgctgccggcgtgcgtcgttccgttcggtctggtgccgccg
gacgacgacgtggccgcgatgacccgggccgcggtggccaaggacctggacgtcgacggc
ggggtgcaccggttcgcggcggacgtgttctacgggggtgggcagtggattctgctgtcc
gcgctgctcgggtggaacctggccgccgcgggtgacaccgccggtgctctgcgacatctg
cggtggatcgccgaccaggcggacgccgacggtgacctgccggagcaggtcccgcaccat
ctgctgcaccccgggtcccgcgcggagtgggtcgcgcgctggggcacggtggccactccg
ctgttgtggtcgcacggcatgtacctgatcctcgccgacgagctcggccttctccctccc
gccgccaaggacgcctga

DBGET integrated database retrieval system