KEGG   Kinneretia sp. DAIF2: G8A07_15070
Entry
G8A07_15070       CDS       T06904                                 

Name
(GenBank) ATP-grasp domain-containing protein
  KO
K22114  dapdiamide synthase [EC:6.3.2.47]
Organism
kia  Kinneretia sp. DAIF2
Pathway
kia00997  Biosynthesis of various secondary metabolites - part 3
kia01100  Metabolic pathways
kia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    G8A07_15070
Enzymes [BR:kia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.47  dapdiamide synthase
     G8A07_15070
Motif
Pfam: ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 LAL_C2 ATP-grasp_5 ATPgrasp_Ter GARS_A
Other DBs
NCBI-ProteinID: QPF74102
Position
complement(3282830..3284101)
AA seq 423 aa
MTAVGYKPLETVLIVDGFSTAAYLAPALRSYGLRCVHLLSSPNLPRQHVEQLQRADYQQC
LVHEGDFDATLAALRPLGIGLILHGFDSALELVDRLGEALDLPWRNPLASSAARRDKELM
TEAVRRAGLRAPEQLLARTVEEALDWARPRLPVVLKPTRSAGVRGVRICRSEEEVREAAA
AVLDGLSFYEDRNEGVLVQRCSQGQEYIVDSVSFEGRHRLVSLWQVERDRRAAPRLEHML
VVDHRESRYRALIDYAFAVLDALELRYGASHLEIMDTPEGPSLIELNARMHGSLDPRLTT
AVSGENHVSATVETFLNPAGFERRLQEAPEFRGHCGHLLLVAPRGGRLARDFIWSEIAAL
PSFVSTKQWVKPGDLLQPTTDLKTALGMVGLFHPRLETLEQDTQRIRALEQQFFADTRAL
EPA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaccgctgttggatacaaacccctggagaccgtcctgatcgtcgacggcttctcgacc
gccgcctacctggcgccggccctgcgcagctacggcctgcgctgcgtccatctgctgagc
agcccgaatctgccgcgccagcatgtcgagcagctgcagcgcgccgactaccagcaatgc
ctggtgcatgagggcgacttcgatgccaccctggcggcgctgcggccgttgggcattggc
ctgatcctgcatggcttcgacagcgcgctggagctggtggatcgcctgggcgaggcgctg
gacctgccctggcgcaacccgctggccagctcggccgcgcggcgcgacaaggagttgatg
accgaggcggtgcgccgcgccgggctgcgcgcgccggagcagctgctggcccgcacggtg
gaggaggcgctggactgggcgcggccgcgcctgccggtggtgctgaagccgacgcgcagc
gccggcgtgcgcggcgtgcgcatctgccgcagcgaggaggaggtgcgcgaggccgccgcg
gcggtgctggatggcctgtctttctacgaggaccgcaacgagggcgtgctggtgcagcgc
tgcagccagggccaggaatacatcgtcgactcggtcagcttcgagggccggcaccggctg
gtcagcctgtggcaggtcgagcgcgaccgccgcgccgcgccgcggctcgagcatatgctg
gtggtggaccaccgcgagtcgcgctaccgcgcgctgatcgactacgccttcgcggtactg
gacgcgctggagctgcgctatggcgccagccatctggagatcatggacacgccggagggc
ccgagcctgatcgagctgaacgcgcgcatgcatggcagcctggatccgcgcctgaccacc
gcggtcagcggcgagaaccatgtcagcgcgacggtcgagaccttcctgaacccggccggc
ttcgagcgccggctgcaggaggcgccggagttccgcggccattgcggccatttgctgctg
gtggcgccacgcggcggccggctggcacgcgacttcatctggtccgagatcgccgcgctg
ccgtccttcgtcagcaccaagcaatgggtcaagccgggcgacctgctgcagccgaccacc
gacctgaagaccgcgctgggcatggtgggcctgttccatccgcggctggagaccttggag
caggacacgcagcgcatccgcgcgttggagcagcagttcttcgccgacacccgggcgctg
gagccggcatga

DBGET integrated database retrieval system