KEGG   Kluyveromyces lactis: KLLA0_E02201g
Entry
KLLA0_E02201g     CDS       T01025                                 

Name
(RefSeq) uncharacterized protein
  KO
K10868  DNA repair protein XRS2
Organism
kla  Kluyveromyces lactis
Pathway
kla03440  Homologous recombination
kla03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KLLA0_E02201g
   03450 Non-homologous end-joining
    KLLA0_E02201g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kla03400]
    KLLA0_E02201g
DNA repair and recombination proteins [BR:kla03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     KLLA0_E02201g
   NHEJ (non-homologous end-joining)
    MRX complex
     KLLA0_E02201g
SSDB
Motif
Pfam: FHA PTCB-BRCT NIBRIN_BRCT_II BRCT Yop-YscD_cpl T2SSC
Other DBs
NCBI-GeneID: 2893993
NCBI-ProteinID: XP_454047
UniProt: Q6CPU2
Position
E:complement(205466..207973)
AA seq 835 aa
MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL
IITNKGKLTKFNEEIIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELNET
KSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGKLLQQGN
YLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDAKLLAN
SSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLLNINQFVN
ILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQSLDSLNFFGGGN
LEVTQNEEKHEPVISHTSESKVKVKEESKAFVPYNDNQDLDTSANGNTKTLPSYITNKSS
LGGMSTEPANQPHTSTKKDDRTELQKVRRKRPRVQQLDNLMMRSSSQQATQIEPDDRNDK
LKLRRIGDTASNVNAEGVLPSNSPSNAENMIKNIKTPDISNKNPTLSAISLLEPGGAEHV
SAKKNLISDGGKSIDAQSSNRIEQNMGNMTELDSRPHSVARLETDLQVRSSTNIITAIAE
TKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISNGNTKWLGR
KNFKKFKKNWPSYLRRTTEGLCSDNTSNQIGREYITMRKYDSRKAKKHIAEEMDEIDIFP
CRSHSNSVGVMDIAIANTEHDSGFRFSNREYSIPTRSLFVADDDDDEENETSNNSALAIY
GQNNEQHYEGVGPAAAVSIRSPATVSTASSVAKLGDTDDEEDDTPRFNFRSRREI
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgtggattgtatcttttatattcgatgatgaagcagaaaagtctcacaaagtatgcaag
gcactccaatatggggtcgaatactcaattggaagatccgcaaaatgtacttttaggata
caaacggataaaagtatttctcgtgttcatttactgataaaatttgatggaagtgacctt
ataataacaaataagggtaaacttacaaagtttaatgaagaaataattcccttagatgag
accattgtggtacacaatcagaatacagtgataaatattggaggtatgccaatcgatgtt
aatgtacgatatttctacgaagaatggaagataccacacagattagaactgaatgaaaca
aaatcactggtttcagattttggtgtgaagctttctgaatccttctctaagaaaaccaca
acacaaatatgttcagatagttcaagctacagcggttgtttatttgctttacttaaaggt
gttcctgttgtaagtatcgagtttttgaaccaaatgggcaaattgttacaacaaggaaac
tatttagattttcagtcaatgtaccaaggccttttgaatcgccacaaattatttccatct
tatagatacgttcctaatgtgctatcaaacatgactttgattgttttcgagcaaaaaatg
tatgatacattgcgttataccattgaagtgggaggcggagatgcaaagttattagccaac
tcttcagagttagataagtttctatcaactaaccatgagcctgccgttgtgcttggctcc
agtatatcacagaaaatgaattcagaaagcacaaaacttttagaggaatttgacaagtct
attgccgaaacctcactacgacatggtgtgaaattgcttaatatcaatcaatttgtcaac
atattacttgagaataagataaatggcttaaaaaagagggacgttgtagatttgacatct
ccctctccagtacagcagaaaaagattcaatcagccaaagcttctgtgaatggtaagaag
acaaaatctaaaccgaatatccaatcattggacagtttaaacttttttggcggtggcaac
ttggaagttacccaaaatgaagaaaagcatgaaccagttatttcccacacttcagaaagt
aaggttaaagttaaagaagaaagcaaagcttttgtcccttataatgataatcaggacctt
gacacttcggccaacggtaatacaaaaactctaccttcttacatcactaacaaaagttct
ttaggtggtatgtccacagaaccagcaaaccaaccccatacttctacaaaaaaagatgat
agaactgaacttcaaaaagtaaggagaaagcggccgagagtacagcagttagataatctt
atgatgagatcttcatctcagcaagcaactcaaattgagcctgatgacagaaatgataaa
ctcaagctcagaaggataggtgacaccgcatcaaatgtgaatgcggaaggagttctacca
tcaaattcaccctctaatgctgagaatatgataaagaatatcaaaacgcccgacatatcg
aacaaaaacccaaccttatcggccataagtttgctagaaccaggtggtgctgaacatgtc
agtgctaaaaaaaacctcatctcagatggcggaaagtcaatcgatgctcaatcgtctaat
cggattgaacagaacatgggtaatatgacagagttagatagtagaccacattctgttgcc
agacttgaaactgacctccaagttagatcctcgacaaatataattactgcaatagcagag
acaaagcagaaggaagtcaaacgcttgcaggaaggaataatcgaagttgatcaatcagaa
ttaacggaaagtgctttgattgattttaaggacgctgctaaaataaatacgattcagata
aagccaagggttttggcttctattccaattagcaacgggaatactaagtggctgggtcgg
aagaacttcaaaaagtttaagaaaaattggccatcctacctgagacgcactaccgagggg
ttgtgctccgataacactagcaatcaaataggcagagagtatattacaatgcgtaaatat
gatagtcgaaaagcaaaaaaacacatagcggaagagatggatgaaattgatattttccct
tgtagatctcacagcaattcagttggtgttatggatatagcaattgcgaataccgaacat
gattcaggatttaggttctcgaacagggaatattccattcccacaaggtctctgtttgtg
gcagatgatgatgatgacgaagaaaatgaaacatccaataatagtgcactagcaatttac
ggtcagaataatgaacagcactatgaaggtgtagggcctgctgctgctgtatcaattagg
tctcctgcgacagtttccacagcatcatcggtggctaaattaggtgatacggatgacgaa
gaagatgataccccacggttcaatttcagatctagaagggaaatttga

DBGET integrated database retrieval system