Klebsiella huaxiensis: DA718_23735 Help Entry DA718_23735       CDS       T05915                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism klw  Klebsiella huaxiensis Brite KEGG Orthology (KO) [BR:klw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:klw03400]     DA718_23735 (mutT) Enzymes [BR:klw01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      DA718_23735 (mutT) DNA repair and recombination proteins [BR:klw03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     DA718_23735 (mutT)  Prokaryotic type     DA718_23735 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like DUF2095 Motif Other DBs NCBI-ProteinID:  QBG09963 Position complement(4967385..4967777) Genome browser AA seq 130 aa AA seqDB search MKKLQISVGIIRNPQGEIFITQRSADAHMANKLEFPGGKIEEGESSEQALARELQEEVGI TVKSCRLFDKLEYQFPDRHITLWFWLVDVWEGEPWGKEGQPGRWMAQNALNAEDFPPANE PVIAKLVQNS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaagaaactgcaaatctcagtcggtatcatccgcaatccgcaaggcgaaatttttata acacagcggtctgctgatgcacatatggcgaataaacttgaatttcccggtggaaaaatt gaagaaggtgagtcgtcagagcaggcattagcgcgtgaattgcaggaagaagtgggcatt actgttaaatcgtgccgcctgttcgataagctggaatatcagtttcctgaccgccatatc acgctgtggttctggctggtagatgtctgggaaggtgaaccgtggggaaaagagggacaa cctggccgttggatggcgcagaatgcgctgaatgctgaggatttccctcccgcaaatgag cctgtgattgcaaaattagttcaaaactcgtga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (4) Pfam (4) All databases (5) Download RDF

DBGET integrated database retrieval system