KEGG   Kaustia mangrovi: HW532_05585
Entry
HW532_05585       CDS       T07196                                 

Name
(GenBank) LysE family transporter
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
kmn  Kaustia mangrovi
Brite
KEGG Orthology (KO) [BR:kmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kmn02000]
    HW532_05585
Transporters [BR:kmn02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   HW532_05585
SSDB
Motif
Pfam: LysE LptF_LptG DUF1345 TraQ
Other DBs
NCBI-ProteinID: QPC45202
UniProt: A0A7S8C8A1
Position
complement(1183606..1184235)
AA seq 209 aa
MDIALFGKSMALGLAIAAPFGPMGALCVNRALERGFWAGVASGLGTALADAFYASLAALG
FAAFSAALGVVDGPLRLFGGVFMIWLGWKSLQAAPAANAARVGARALAGTVSATFLLTVT
NPMTILSFAAIFAGLGLAGEGDGAGVATVVAGVFLGSLGWWFALSGGVSLAHRRLPPGFA
VWTARISGAILILFGVGAIGSLLWGLIRT
NT seq 630 nt   +upstreamnt  +downstreamnt
atggatatcgcgctgttcggcaagagcatggcgctcggccttgcaattgccgcgccgttc
ggcccgatgggcgcgttgtgtgtcaacagggcgctcgaacggggcttctgggccggcgtc
gcaagcggtctcggcacggcgcttgccgatgcgttctatgccagcctggccgcgcttggg
ttcgccgccttctccgccgcgctcggcgttgtggacggcccgctgaggctgttcggcggt
gtattcatgatctggctcggctggaagagcctccaggccgcgcccgccgcaaatgctgcc
cgggtcggggcgcgggcgctcgccggaacggtgtcggccaccttcctgctgactgtcacc
aatccgatgacgatcctgtccttcgcggcgatcttcgcggggctcgggcttgccggtgag
ggggacggtgcgggcgtggcgacggtcgtcgccggggtctttctcggctcgcttggctgg
tggttcgcgctgagcggcggggtctcgctcgcccatcggcggcttccgccgggctttgcc
gtgtggacggcgcggatatcgggcgcgatcctgatcctgttcggtgtcggggcgatcggc
tccctgctctgggggctgatacggacctga

DBGET integrated database retrieval system