KEGG   Kluyveromyces marxianus: KLMA_20618
Entry
KLMA_20618        CDS       T05269                                 

Name
(RefSeq) DNA repair protein XRS2
  KO
K10868  DNA repair protein XRS2
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx03440  Homologous recombination
kmx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KLMA_20618
   03450 Non-homologous end-joining
    KLMA_20618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kmx03400]
    KLMA_20618
DNA repair and recombination proteins [BR:kmx03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     KLMA_20618
   NHEJ (non-homologous end-joining)
    MRX complex
     KLMA_20618
SSDB
Motif
Pfam: FHA Yop-YscD_cpl GD_N NIBRIN_BRCT_II
Other DBs
NCBI-GeneID: 34715079
NCBI-ProteinID: XP_022674934
Position
2:1271794..1274283
AA seq 829 aa
MWIISYGYEDASGKHYSQCKALKECTEYSIGRSVNCELRIQQDKSISRVHLVVKYEKNEL
SITNKGKLTKVNNKPVRIDECIVIQNHDIVFDIGGSPINVEIHFSYQEWKIPHKLSLEEE
KSTILQYGVKLCESFSKKSTLQVFSEGSSHTGCLFALIKGVPVVSTEFLNCICQLLKEDN
YLNFESSFQAIIRRFNLFPSYNHVPNVLSNICIMVFEQKLFDTLRYTIESGGGMIKLLTS
TSEIDGSVIDNEKKIIVLSTNTVTDTQASKMNTSFSNKFSEFGIVTHSLNDFVNALINND
LNALSEQKKPTTEEPTREISQPVVVKSKARIKPKVQRLDSLTCFGGGNQLKIENSEYNTP
SKTSDDSWNKGSEHESKSTNSFEAVEPTPIVPKSSEIVTPPTDTKENISSITTAFAKENE
PSIALDSKKRKRRPKVQQLGNLMMRDIPKVATESFQEQRDGDSKRIKLETDTSTEKPILA
KSLPRNDKEDSNLIKYKYDSTKLGKENDATNNRYKQNDDLDDVRKGVISDESTPQDQPSS
FETSEKSSPRVTDRPRSIAKLETNLPERRKTNDIVSAIAETKQKEVRRFQEGIFEVDQSE
LTESSLEEFKNVAKVEKIKVKPRILHPTVVSDKSAIWAGRKNFKRFTKKWPLYMKSYSIE
ANTGHIPYPKDNNNNRYIAMKRFDYRKDGKSEENNGINIEIDFRLPNRMEGSNELSLQQS
GETESAQESRVASGFGFKSKPKSVPERNTLFITEDDDDSYDYDAPAAHNQLVVHGNKIEM
EDDISLQSNRSVSFGTNSLERSNSADADTDDDDDENNTRRFNFRSRRRK
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgtggattatatcatatggatacgaagatgcttcaggtaaacactactcgcaatgcaag
gctttaaaagagtgtacagaatacagcatagggagatctgtaaactgcgaactacgaatt
caacaggataagagcatatcaagagttcacttggtagtaaaatacgagaagaatgagttg
agtataaccaataagggtaaattaaccaaagttaataataaaccagttcgaattgatgaa
tgcatcgtaattcaaaatcacgacatagtttttgatatcgggggatccccgatcaatgta
gaaatacacttctcctatcaagagtggaaaataccacacaaactatcattggaagaagaa
aaatcaacgattttacaatacggagtaaaattatgcgaatcattctctaagaagtcaaca
ctacaagttttttctgaaggttcaagccatacaggttgtttatttgctcttataaaaggt
gtaccagttgtatccacagaatttctcaattgtatatgtcagttgttgaaggaagataac
tacttaaattttgaatcgtctttccaggcaattatccggagattcaacttatttccttct
tacaatcatgtccccaatgttttatcaaacatatgtataatggtttttgagcaaaagcta
ttcgacacccttcgatatactatcgaaagtggaggcggtatgataaagttgctaacttct
acttctgagatcgatggttctgtgattgataatgaaaaaaagatcattgtactcagtact
aatacggtcacagatactcaggcaagtaagatgaatacatctttctctaacaagtttagc
gagtttggtatagtgactcacagtctaaatgactttgttaacgccttgattaataatgat
ttaaatgccttaagtgagcagaaaaaaccaaccacagaggaacctaccagagagatttca
caacctgttgtagtgaaatcaaaggctaggataaaacctaaagttcaaaggctagatagc
ttaacctgctttggcggtggtaaccaattaaagattgaaaacagtgaatataacactcct
tccaagacgtctgatgatagttggaataaagggtcggaacatgaatcaaaaagcaccaac
agttttgaagcagttgaacccacaccaattgttccaaaatcttcagaaattgttactcct
cctactgatacaaaggaaaatataagttcaataacaacggcatttgctaaagagaatgaa
cccagtatagctttggattctaagaaaagaaagagaagaccaaaagtgcaacagcttggg
aacttgatgatgagagatattccgaaggtagcgacagaaagtttccaggaacagcgtgat
ggggactcaaaaagaataaagttagaaactgacacaagtaccgaaaaacctattttggcc
aaaagcctaccacgaaatgacaaagaagacagcaatttaatcaagtataagtatgactct
acaaaacttggtaaggaaaatgatgctacgaacaatagatataaacaaaatgatgattta
gatgatgtaagaaaaggagtaatcagtgatgaatctacaccacaggatcaaccttcctct
tttgaaacatccgaaaaatcttcaccaagagttacagatagacctcggtctatcgcaaaa
cttgaaactaatttaccagagagaaggaaaactaacgatattgttagtgctattgctgaa
acaaaacagaaagaggttcgcagattccaggaagggatatttgaagttgatcaatcagaa
cttactgaaagctccttagaagagtttaaaaatgttgctaaagttgaaaagattaaggtg
aaaccgcggatccttcatcctactgttgtctccgataagtctgccatatgggcaggtcga
aagaatttcaagcgctttaccaaaaaatggccgttatacatgaaatcatattcaattgag
gctaatactggacatattccctatcctaaagataacaacaacaacaggtatatagcaatg
aaaaggtttgattatcgaaaagacgggaagtctgaagaaaacaatggtattaatattgaa
atagattttaggttaccaaacagaatggaagggagtaatgaactaagcttacaacagagc
ggagaaactgaatcggcacaagagtcaagagttgcatctggtttcggattcaaaagcaaa
ccaaaatctgtgccagaaagaaacactttattcattacagaagatgatgacgatagttat
gattatgatgcgccagcagcacataatcaattagtagtacatggcaacaaaatagagatg
gaggatgatatttcgttgcagtcaaaccggagcgtcagttttggcaccaattcgttggaa
cggtcaaactctgctgatgcagatactgatgatgatgatgatgaaaacaatactcgtcgc
ttcaatttcaggtctaggaggcgaaaatag

DBGET integrated database retrieval system