Kordiimonas sp. SCSIO 12610: KFF44_02260 Help Entry KFF44_02260       CDS       T08324                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism koz  Kordiimonas sp. SCSIO 12610 Brite KEGG Orthology (KO) [BR:koz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:koz03400]     KFF44_02260 (mutT) Enzymes [BR:koz01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      KFF44_02260 (mutT) DNA repair and recombination proteins [BR:koz03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     KFF44_02260 (mutT)  Prokaryotic type     KFF44_02260 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like Motif Other DBs NCBI-ProteinID:  UTW55735 Position 480525..480968 Genome browser AA seq 147 aa AA seqDB search MIDDCPEPNVRIDAGLPTVLVAAIALIDVDGRVLIAQRPEGKSMAGLWEFPGGKVEAGEI PEAALIRECKEELDIDITAACLAPFAFASHSYEKFHLLMPLYLCRKWEGLVNPQEGQATK WVRIRDLNEYPMPEADIPLVAMLRDFL NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgattgatgattgtccagaaccaaatgtgcgaatagatgctggcttgccaactgtattg gttgccgcaattgccctgatcgatgtcgatggtcgtgtattgattgcccagcgaccagaa ggtaaatcgatggcgggcctttgggaatttccaggcggcaaggttgaagctggtgaaatt ccagaagctgcgctcattcgagaatgcaaagaagaattggatattgatatcacggcggca tgccttgctccgtttgcatttgcatctcattcctatgaaaaatttcacctgttgatgccg ctttatttatgccgaaaatgggaaggccttgttaaccctcaggaggggcaggcgactaag tgggtgcgaattcgtgatttgaatgaatatccaatgcccgaagcggatattccgcttgtc gcgatgttgcgtgattttctttaa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system