KEGG   Kribbella qitaiheensis: F1D05_29275
Entry
F1D05_29275       CDS       T06749                                 

Name
(GenBank) glycoside hydrolase family 15
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
kqi  Kribbella qitaiheensis
Brite
KEGG Orthology (KO) [BR:kqi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F1D05_29275
Enzymes [BR:kqi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     F1D05_29275
SSDB
Motif
Pfam: Glyco_hydro_15 TPR_4
Other DBs
NCBI-ProteinID: QNE23222
UniProt: A0A7G6XAF7
Position
complement(6171063..6172199)
AA seq 378 aa
MIAALDLSELTRLRELARHSHAVITEHQDPAGAYPAAPTFSAYRGYAWLRDGSFTAEGIS
RYGDLVSADRFHDWVNDVLRRRRAQVDDLRAALARGEVPPNEAMLPTRFTFDGKDRSDPW
WDFQTDGYGMWLWSVVTHATRHGLDLSRWQEGIDVAVDYLVAFWDRPCYDWWEEHVEHRH
VSTLGAIHGGLVAVGTCSGLRSAPWSAAALKVAADIRSLVSAEGIVDGHLVKWLGSSAVD
GSLPACVVPFGLVAPDDGLAAMTRAAVAKDLDFDGGVHRFTADVFYGGGQWILLSALLGW
NLAAAGDTAGALRHLRWIADQVDEHGDLPEQVPHHLLHPGSRDEWIARWGTVATPLLWSH
GMYLILTDELGITPKDAR
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgatcgccgccctggacctgtccgagctcacccgtctgcgcgaactcgcccggcacagc
cacgccgtcatcaccgagcaccaggacccggccggcgcctacccggccgcgcccaccttc
tcggcgtaccgggggtatgcctggctgcgcgacggttcgttcaccgcggagggcatctcg
cggtacggcgatctggtgtcggcagaccggttccacgactgggtgaacgacgtactgcgt
cgtcgccgcgcgcaggtggacgacctgcgcgcggcgctcgcccgcggtgaggtgccgccg
aacgaagcgatgctgccgacgcggttcaccttcgacgggaaggaccggtcggatccgtgg
tgggacttccagaccgacggctacgggatgtggctgtggtcggtggtcactcacgccacg
cggcacgggttggatctgtcgcgctggcaggaggggatcgacgtagcagtcgactacctg
gtcgcgttctgggaccggccttgttacgactggtgggaggagcatgtcgagcatcggcat
gtctccaccctgggcgcgatccatggcggattggttgctgtcggcacctgctccgggttg
cggtcggcaccgtggtcggcggcggcgctgaaggttgccgccgacatccgttcgctggtg
tcggcggagggcatcgtggacgggcacttggtgaagtggctcgggagttcggccgtcgac
gggtcgttgccggcttgcgtcgtaccgttcgggctggttgctcccgacgacggcctcgcc
gcgatgacgcgggcggcggtcgcgaaggacctcgacttcgatggtggggtgcaccggttc
acggcggacgtgttctacggtggtggccaatggatcctgctgtcggcgctcctcggctgg
aacctcgccgccgcgggtgacacggccggtgccctgcggcaccttcgctggatagccgac
caggtggacgaacacggcgacctccccgaacaggtcccgcaccacctcctgcaccccggc
tcccgcgacgaatggatcgcccgctggggcaccgtggcgaccccgctcctgtggtcccac
ggcatgtacctgatcctcaccgacgaactcggcatcaccccaaaggacgcccgatga

DBGET integrated database retrieval system