KEGG   Ligilactobacillus animalis: FAX13_00685
Entry
FAX13_00685       CDS       T06852                                 

Name
(GenBank) LPXTG cell wall anchor domain-containing protein
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lani  Ligilactobacillus animalis
Pathway
lani00500  Starch and sucrose metabolism
lani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FAX13_00685
Enzymes [BR:lani01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     FAX13_00685
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor DUF4222 Hamartin
Other DBs
NCBI-ProteinID: QCQ05085
UniProt: A0A4P8K8P8
Position
154863..157157
AA seq 764 aa
MYKAGKNWVVASVAVAAMVAGSAKVSADQTTNDTTSDSAIVTSTETPETSDKDTTYTLKN
DDSDKGLTQEAKATTTTKDADTVAETETPVADVAQTDTTTNKESEAVTEDKADAKAPVAD
DNVSDETAKDVSKEQAPKETDGVKELDNLAKLNDTAKKIAKDANLDPSKLTDEQIDSLNK
VVVDKANGTKMTYKNFEDISKALINQDNRYAIPYFNASQIKNMPAAHTRDAETGEVTDLD
IWDSWPVQDPKTGYVSDWNGYQLVIAMMGRPGYEDNHIYLLYNKYGDNDFSHWKNAGSIF
GYNESYDIQEWSGSAIVNNDNSIQLFYTKNDNSGDKHNDQRVATATLYLDHTDNDVSIAR
VENDRVIFAGDGYHYQTYDQWKQHNTFDDDFTLRDSHVVETDNGDRYLVFEANTGTQDYQ
GEHQIYKWSNYGGDAAYNTNSLFDILSHDDYKNKAKWANAAIGILKLTNDQKNPQVEEVF
NPLMTAPMVSDEIERPNVVKLGDKYYLFAASRLTRGVNNKLINTANTTVGDNVIMVGYVS
DNLMSGYQPLNGSGVVLTASVPANWRTATYSYYAVPVAGYTDRVLVTAYMTNRGGVAGEG
KNSTWAPSFLVQINPDGTTQVLSNITNQGDWIWDGSSENPAMLGDFEMAALPGDKERTIN
WDLIGYGAKKHDPVYIGEPDRPTTPTDPETPSTPTDPDRPTDPEEPFVPEEFIVTDDPTP
NTPEVSRSSMLPQAGEKQSPVAMILAGMSAIMMSLGLAKTKKRK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgtacaaagctggtaagaattgggtcgtagcttcagttgcagtagctgctatggttgct
ggttcagctaaggtttctgcggatcaaacaactaatgatacgactagcgatagtgctatt
gtaacatcaactgaaactccagaaacatcagacaaagatactacatatactttgaagaat
gacgattctgataaaggattgacacaagaagctaaggctactacgactactaaagatgct
gacactgtagctgaaacagaaacaccagttgcagatgttgctcaaactgatactacaacg
aacaaggagtcagaagcggtaacagaagataaagcagatgctaaggcaccggttgctgat
gataatgtgagtgatgaaacagcaaaagatgtttccaaagagcaagcacctaaagaaact
gatggtgttaaagaattagacaatttagctaagttaaatgatacagctaagaaaattgct
aaggatgctaatttagacccaagtaagttgactgatgaacagatcgattcattgaataaa
gtcgtggtggataaagctaacggtactaagatgacatataagaactttgaagatatttca
aaggctttgatcaaccaagataatcgttatgcgatcccttattttaatgcttcacaaatt
aaaaatatgccagctgcccacacacgtgacgcagagacgggtgaagtaactgatttagat
atttgggattcttggccagttcaagatccaaaaacaggttatgtttctgactggaatggg
tatcaattagtgattgccatgatgggacgcccaggatatgaagataaccatatctattta
ctatacaataagtatggtgacaatgatttttcacattggaaaaatgcaggatctatcttt
gggtataatgaatcatatgatattcaagaatggtcaggttcagcaattgtaaataatgat
aattcgatccaattattctatacaaaaaatgataatagcggtgacaaacacaatgatcaa
cgtgtagctactgccacattatatttagatcataccgataatgatgtatcgattgctagg
gttgaaaatgatcgtgttatttttgccggtgatggttatcactatcaaacatatgatcaa
tggaaacaacataatacatttgatgatgactttactttacgggattctcacgtagttgaa
actgataatggagatcgttacctagtatttgaagctaatacaggaacacaagattatcaa
ggcgaacatcaaatttacaagtggtcaaattatggtggtgacgctgcttacaacactaac
agtttatttgatattttgagtcatgatgattacaagaacaaagctaagtgggctaatgca
gcaattggtattttgaagctaacaaatgaccaaaaaaatccacaagtagaagaagttttc
aatccgttgatgactgcgccaatggtcagtgatgaaattgaacgccctaatgtagtgaaa
ttaggagataaatactatctctttgcggcaagtcgtttgactcgtggagttaataacaag
ttaataaatacagcaaatactactgttggcgataatgttatcatggtgggatatgtatca
gataatttgatgagtggttaccagcctttaaatggatctggcgttgttttaacagcttct
gttcctgcaaactggcgaacagctacgtactcctactatgcagtaccagttgctggttac
actgacagagtattagtgaccgcgtatatgacaaatcgtggtggtgttgcaggggaaggc
aaaaattcaacttgggcaccaagtttcttagttcaaatcaatccagatggtacaacacaa
gtactttcaaatatcacgaaccaaggggattggatctgggatggttctagtgagaatcca
gctatgttaggcgattttgaaatggctgctttaccaggtgataaagaacgtacaatcaat
tgggatctgatcggatatggtgctaagaaacatgatccagtttatattggtgaaccagat
cgcccaacaactccaaccgatccagaaacaccaagcacaccaactgatccagatcgtcca
actgatccagaagaaccatttgtaccagaagaatttatcgtaacagatgatcctacgcct
aatacaccagaagttagtcgttcatcaatgttaccacaagctggtgaaaagcaaagtcca
gtagctatgatcctagcaggtatgagtgcgatcatgatgagccttggcttagcaaaaaca
aagaaacgtaaataa

DBGET integrated database retrieval system