KEGG   Leishmania braziliensis: LBRM_16_0500
Entry
LBRM_16_0500      CDS       T01113                                 

Name
(RefSeq) putative fucose kinase
  KO
K25315  arabinokinase / fucokinase / arabinose-1-phosphate guanylyltransferase / fucose-1-phosphate guanylyltransferase [EC:2.7.1.- 2.7.7.- 2.7.1.52 2.7.7.30]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00520  Amino sugar and nucleotide sugar metabolism
lbz01100  Metabolic pathways
lbz01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LBRM_16_0500
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     LBRM_16_0500
    2.7.1.-  
     LBRM_16_0500
   2.7.7  Nucleotidyltransferases
    2.7.7.30  fucose-1-phosphate guanylyltransferase
     LBRM_16_0500
    2.7.7.-  
     LBRM_16_0500
SSDB
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 5414174
NCBI-ProteinID: XP_001563653
UniProt: A4H8H4
Position
16:complement(168674..172363)
AA seq 1229 aa
MSLNFLFSVPRCLAEYNGAKKLLGDAASLTVHEHSAKGDVAAPGLFCGCDPEGKPLGSGG
GTVHLLHECYLDEQRHAPASAKKSFLSWLRLADKDGRVIVHAGGLSRRLPAYAAVGKALV
PLPPCRWRRGSQLSRTLLSTQMPMYREIITTAPANLRTLIACGDVCVYLRGSLPSFSHLA
DRDVVCFGIRTDTHILENHGVLFTTCEKPLELDYMLQKPSLAEIRQRTAEGRHSFLLDVG
MWMLSDRAVAILARKCLGRALDTDDVNGGEHDGHRCAVVCNSYELYSEFGTALGRNASQA
DPEVSGLKAGVVELRDAVFLHYGTCRQLISSTAKLQSCESPTPSWSWGTPFDGVLAPECN
GGKEARLPTAAADAPAGDAGEELDFAAGDAVPLLATPSSVIVQNSVLLAPLDGSAAAAAA
AAAGASAFAPVSPVHHLWVESSWVGARWVLRGQHILTGIPRNDWALALPLGVCVSVVSVL
PAALGVHGCDDGAALHAARPYHIDDAFRGDVRNGSTVYMGMLLHDWLSSRGFSVAELYPT
ARAADRDTAQPLDISEAALFPVCVTQQQLGDFLYVATLSLEATTGGGAAVDPVRLSAGQS
VWRTQPRVSAMDLLRLADVPAILRNNEYYERRMLTLMLALVGANPVFQGGCSSVVSVPNT
PMATPALSSVRPSVLSDSMIALLQQQFSLLDLSRVAKRVVELGVTLPRRSGTTEEWDGVD
ATAKTVSLPHQPDSIESFGSDADATASSWARIFTDERSPNGDRRGAPLCLAPGRIVTAHY
HMFVSRVIELALEAMDAAQPPMTAAEKARRLELLHAPSAKEARSLVTRHSATAFAELCAA
IVDSFPGERHNPEIGVYLDQIIWGRCPIRIDLAGAWTDTPPYTILSGGSVINVAVELNGQ
PPVQVYVRARKDPTIVILSIDSGEQLRISSFDEIRTYTAVQNSFSIPKAALALCGFLPEF
CTTAYATLTEQLAARFGNHGLEISLFVAIPVGSGLGTSSIVAGTVLQSLAEFCKLPWDVH
DVCRRVLLIEQMLTAGGGWQDQYGGLFEGVKLVQCVPGLPCLPTVRWMPDNVYTDPRFAS
CHLLYYTGITRTAKGILTEIVREVFLNSGATLQLLHEIGGATTAAMYNAITTGNYERYAR
LIHQTWDQKKRLDSGVCNPAVQSIVDIVEPYVWGLTLPGAGGGGYMYMCAKDEACARRIR
ELLTANPPNGNARFVEMSVSSSGLKVSRS
NT seq 3690 nt   +upstreamnt  +downstreamnt
atgagcctgaactttctcttcagcgtcccccgctgcttggcagagtataatggagcaaag
aagctcctgggggatgcggcctcgttaactgtgcatgagcactctgcgaagggcgacgtg
gcggcgcctgggctgttctgcgggtgcgacccggagggcaagccgctgggctccggcggt
ggcacggtgcacctactgcacgagtgctacttagacgaacagcgtcatgcacctgcatct
gcgaagaagtcgttcctgtcgtggctgcgacttgcggacaaggatggccgcgtgattgtg
cacgctggtggcttgagccgccgcctgccggcgtacgcggcagtgggcaaggcactggtg
ccgttgccgccgtgccggtggcgccgtggcagccagctgtctcgcacgctgctctcgacg
caaatgccgatgtaccgtgagatcatcacgacggcgcctgccaacctgcgcacgttgatc
gcgtgcggcgacgtctgcgtgtacctcagaggttctctgccgtctttttctcacctcgcg
gatagggatgttgtgtgctttggcattcgtactgacacgcacatcttggagaaccatggc
gtgctcttcacgacatgcgagaagccacttgagctggactacatgctgcagaaaccctcg
ttggccgaaatacgccagcgcaccgccgagggcaggcattcgtttctcttggatgtgggt
atgtggatgctgagcgaccgcgcagtggcgattctggctcgcaagtgccttggcagagca
ctggacactgatgacgtgaacggcggcgagcatgatgggcaccgctgcgcggtggtgtgc
aactcatacgagctgtactcggagtttggcactgcactgggccggaacgcgtcgcaagca
gatccggaggtctccggactgaaggcgggcgttgtggagctgcgcgatgcggtgtttctg
cactacgggacgtgccgtcagctgatctcgtcgacagcgaagttgcagagctgcgagtct
ccgacgccgtcgtggtcgtggggcacgccgttcgacggtgtacttgcgcctgagtgcaac
ggcgggaaggaggcgcggctgcctactgcggctgcggatgcgccagcgggcgacgcgggg
gaggagctggactttgctgctggcgacgcagtgcctctgcttgcgacgccatcgtcggta
attgtacaaaactctgtgctacttgcacctctggatgggtccgctgccgctgccgctgct
gctgctgctggagcatccgcattcgccccggtatcgcctgtgcaccacctctgggtggag
agcagctgggtgggtgcgcggtgggtgctgcggggtcagcacatcctgacggggatcccg
cgcaatgactgggcgcttgcactgccgcttggtgtgtgcgtgagcgttgtgtctgtgctg
cccgctgcgcttggtgtgcacggctgtgatgacggtgctgcactgcacgctgcgcggccg
taccacatcgacgacgcgttccgtggagacgtgcgcaacggctcgacggtgtacatgggg
atgctcctgcacgactggctgtcgagtcgaggtttcagcgttgcggagctataccctact
gcgcgggctgcggacagagataccgcgcaaccactggacatctccgaggctgcactgttc
cccgtgtgcgtgacgcagcagcagctcggcgacttcctgtacgttgctacgctgtcgctg
gaggcgacgactggcggcggcgctgctgtggaccctgtgcgactctctgctggacagtct
gtgtggcgaacgcagccgcgcgtgtctgcgatggacctgctgcggctggcggacgtgcct
gcgatactgcgcaacaacgaatactacgagcggcgcatgttgacgctgatgcttgcgctc
gtgggtgctaaccccgtgttccagggtgggtgcagctcggttgtgtctgtgccgaacacg
ccgatggccacgcctgcactgtcgagtgtgcggccgtcggtgttatctgactcgatgatc
gcgctgctgcagcagcagttctctctgttggacctgagtcgcgttgcaaagcgcgtagtg
gagcttggcgtgacgctgccgcggcgcagcgggacgacggaagagtgggacggggtggac
gcaactgccaagacagtatcgctgccacaccagccagactcgatagagtcatttgggagc
gatgccgatgctactgcgagtagctgggcacgcatcttcacggatgagaggagcccgaac
ggtgaccgcaggggcgcgccgctgtgcttggcgcctggacgcatcgtgacggcgcactac
cacatgtttgtgagccgcgtgatagagctcgcgctggaggcgatggatgctgcgcagccg
ccgatgactgcggcggagaaggcgcggcgccttgagctactgcatgcgccgagcgcgaag
gaggcccgctcgctagtgactcggcacagtgccaccgccttcgcggagctatgcgccgcc
attgtggactcctttcctggtgagcgccacaacccagaaattggtgtttaccttgaccaa
atcatctggggtcgctgccccatccgtatcgaccttgccggtgcttggacggatacgccg
ccgtacacgatcctgagcggcggcagcgtgatcaacgttgccgtggagctgaacgggcag
ccaccggtgcaggtgtacgtgcgtgcacgcaaggacccgaccatcgtcatactctcgatc
gactccggcgagcagctgaggatctcgagcttcgacgaaatccgcacgtatacggcggtg
cagaactcgttctcgattccgaaggctgcacttgcgctgtgcgggttcctgccagagttc
tgcacgacggcgtacgcgacgctgacggagcaactggcggcgcggtttggcaaccacggg
ctggagatctcactgtttgtggcgatcccagtggggtccggactggggacgagctccatc
gttgccggcaccgtgctgcagtcactggcggagttctgcaagctgccgtgggacgtccac
gatgtgtgccgccgcgtgctgttgattgagcaaatgctgactgctggtggcgggtggcag
gatcagtacggcggcctgttcgagggtgtgaagctggtgcagtgtgtgcctgggctaccg
tgcttgcctactgtgcgctggatgccggataacgtgtacacggacccgaggtttgcttcg
tgccaccttctctactacacggggatcactcggacagcaaagggcattcttacggagatt
gtgcgtgaggtgtttctgaacagcggtgcgacgctgcagctactgcatgagataggtggc
gctaccactgccgcaatgtacaacgctatcacgaccggcaactacgaaagatacgcgcgg
cttatccaccagacgtgggatcagaagaagcggctggacagcggcgtgtgcaaccctgca
gtacagtcaatcgtggacattgtggaaccgtacgtgtggggtctgacactgcctggcgct
ggtggtggtggctacatgtacatgtgcgcgaaggacgaggcgtgcgctcggcggattcgc
gagttgttgacagcgaatccgccgaatggcaatgcccgcttcgtggagatgagcgtgtcg
tcgtccggtctgaaggttagccgctcttag

DBGET integrated database retrieval system