KEGG   Leishmania donovani: LDBPK_160450
Entry
LDBPK_160450      CDS       T02289                                 

Name
(RefSeq) fucose kinase, putative
  KO
K25315  arabinokinase / fucokinase / arabinose-1-phosphate guanylyltransferase / fucose-1-phosphate guanylyltransferase [EC:2.7.1.- 2.7.7.- 2.7.1.52 2.7.7.30]
Organism
ldo  Leishmania donovani
Pathway
ldo00520  Amino sugar and nucleotide sugar metabolism
ldo01100  Metabolic pathways
ldo01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LDBPK_160450
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     LDBPK_160450
    2.7.1.-  
     LDBPK_160450
   2.7.7  Nucleotidyltransferases
    2.7.7.30  fucose-1-phosphate guanylyltransferase
     LDBPK_160450
    2.7.7.-  
     LDBPK_160450
SSDB
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 13393101
NCBI-ProteinID: XP_003859733
UniProt: A0A504XQ84 E9BCP9
Position
16:complement(149017..152577)
AA seq 1186 aa
MNVSFLFSLPRSLAEFKGAGKLLADAAALPLGERGAKGDVAVPGLFCGCDPEDRPLGSGG
GTVHLLHACYVDEQRHAPASAKRSFLSWLRLADNDGRVIVHAGGLSRRLPAYAAMGKALL
PLPPCRWHRGSQLSRTLLSTQVPMYRGIVTAAPARLRTLIACGDVCVDARGALPSLAPFA
DSDVLCFGIRADADLLQNHGVLFMARERPLDLDYMLQKPSLDEVRRRVAEGRHSVLLDVG
MWMLSDRAVEVLARKCLGGALDAEDATGGGHDGHRCTAVRTAYDLYSEFASALGNHAPSA
DPEIAGLKASVVELRDAEFLHYGTNRQLISAAATLQGRESPTPPWSWGAPFDGVLAPAGG
ATEELDFAAGDAMPLLATPSSVIVQNSVVLAPLDGSAAAAAADAPAGAPLSPVRHLWVES
SWVGARWVLRDQHILTGIPRNDWALALPPGACVSVVPVLPAALGGCGGGAAPHAARPYHM
DDAFRGDVRSGSTMYMGVRLHDWLSSRGFSVAELYPAARAADGGAAQPLDIYEAALFPVC
ATEQQLGDFLYVATLPLEAATGGCAGADAARLAAGQAVWRTQPRVSAMDLLRLTDVPAML
RNSEYYERRMLTLMLALVASDPAVLCARSLVLSGPMIALLQQQFFLLDLNRVAQRVVELG
VPLPRRSGPTEWWGGVDAAGNAVALSRQAAPAAPLAKGAAASAGSWAQMFSDEGSPSGGG
RGAPLCTAPGRIVAAHYHAFASRLMELALEAMDAAEPPVSAAEKARRLALLRAPSAEEAR
SLVALHDAAALAELRAAIMDSFPDERHDPEMGVHLDQIVWGRCPIRIDVAGAWTDTPPYA
ILSGGSVINVAVELNGQPPVQVYVRVREDPIIVMHSIDSGEQLSVSSFDEIRTYATMQNP
FSIPKAALALCGFLPEFCATEYATLREQLAARFGGHGLEISLFVAIPTGSGLGTSSIVAG
TVLRSLAEFCKLPWDNHDVCRRVLLIEQMLTAGGGWQDQYGGLFEGLKLVQCVPGLPCLP
TVRWMPDSVYTDPRFAACHLLYYTGITRMAKSILGEIVRDVFLNNGATLQLLREMGGPTT
AAMYDAITAGNYKGYARLVHRTWEQKKRLDDGVCNPAVQSIVDVVEPYVWGLTLPGAGGG
GYMYMCAKDEACARRIRELLTANPPNGNARFVEMSVSASGLQISRS
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgaacgtgagctttctcttcagcctcccccgcagcctggcggagttcaagggagcgggg
aagctgctggcggacgcggctgcgctccctttgggggagcgcggtgcgaagggcgacgtg
gcggtgcctgggctgttctgcgggtgcgacccggaggacaggccgctgggctccggcggt
ggcacggtgcacctgctgcacgcgtgctacgtggacgagcagcgccacgcacctgcgtcc
gcgaagaggtcgtttctgtcgtggctgcggctggcggacaacgatggccgcgtgattgtg
cacgctggcggcctgagccgccgcctgccggcgtacgcggcgatgggcaaggcgctgctg
ccgctgccgccgtgccggtggcaccgtggcagccagctgtctcgcacgctgctctcgacg
caggtgccgatgtaccgggggatagtgacggcggcgccggcccgcctgcgcacgctgatt
gcgtgcggtgacgtgtgcgtggatgcgaggggtgcgctgccgtcgcttgcgccgttcgcg
gacagtgacgtgctgtgcttcggcattcgcgcagacgcggacctcttgcagaaccacggc
gtgctcttcatggcacgcgagaggccactcgacctggactacatgctgcagaagccgtcg
ctggacgaggtccgccggcgcgtggcggagggcaggcactcggttcttctggacgtgggc
atgtggatgctgagcgaccgcgcggtggaggtgctggctcgcaagtgtctgggcggtgcg
ctggacgcggaggacgcgaccggcggcgggcacgacgggcaccgctgcacggcggtgcgc
accgcgtacgacctgtactcggagttcgcttctgcgctgggcaaccacgcgccgagcgcg
gacccggagatcgcggggctgaaggcgagcgttgtggagctgcgcgacgccgagttcctg
cattacgggacgaaccggcagctgatctcggcggcggcgacgctgcaggggcgcgagtcg
ccgacgccgccgtggtcgtggggcgcgccgttcgacggcgtgcttgcgcctgcgggcggc
gcgacggaggagctggactttgctgctggtgacgcgatgccgctgcttgcgacgccgtcg
tctgtgattgtgcagaactccgtggtgcttgcgccgctggacgggtccgctgcggccgct
gctgcggatgcgccggccggtgcgccgctgtcgcctgtgcggcatctgtgggtggagagc
agctgggtgggcgcgcggtgggtgctgcgggaccagcacatcctgacggggatcccgcgc
aacgactgggcgcttgcgctgccgcccggcgcgtgcgtgagcgtcgtgcctgtgctgccc
gctgcgcttggcggctgcgggggcggtgccgcgccgcacgctgcgcggccgtaccacatg
gacgacgcgttccgcggcgacgtgcgcagcggctcgacgatgtacatgggtgtgcgcctg
cacgactggctgtcgagccgcgggttcagcgtagcggagctgtaccctgctgcgcgtgct
gcggacggcggtgctgcgcagccgctggacatctacgaggctgcgctgttcccggtgtgc
gcgacggagcagcagcttggcgacttcctgtacgttgcgacgctgccgctggaggctgcg
accggcggctgcgctggcgcggacgctgcgcggcttgccgctgggcaggctgtgtggcgg
acgcagccgcgcgtgtctgcgatggacctgctgcggctgacggacgtgcctgcgatgctg
cgcaacagcgagtactacgagcggcgcatgctgacgctgatgcttgcgctcgtggcgtct
gaccccgcggtgctgtgtgcgcggtcgctggtgctgtctggcccgatgattgcgctgctg
caacagcagttcttcctgctggacctgaaccgcgtggcccagcgcgtcgtggagctgggc
gtgccgctgccgcggcgcagcgggccgacggagtggtggggcggggtggacgcagctggg
aacgcggtggcgctgtcgcgccaggcggccccggcggcgccgcttgcgaagggcgcggct
gcgagtgcagggagctgggcgcagatgttctcggacgagggcagcccaagcggtggcggc
aggggtgcgccgctgtgcactgcgcctggccgcatcgtggcggcgcactaccacgcgttt
gcgagccgcctgatggagctcgcgctggaggcgatggatgccgcggagccgccggtgtct
gcggcggagaaggcgcggcgcctcgcgctgctgcgtgcgccgagcgcggaggaggcccgc
tcgttggtggctctgcacgatgccgccgcgctcgcggagctacgcgcggccatcatggac
tcctttcccgacgagcgccacgacccggagatgggcgtgcaccttgaccaaatcgtctgg
ggccgctgccccatccgcatcgacgtggcgggggcatggacggatacgccgccatacgcg
atcctgagcggcggcagcgtgatcaacgttgccgtggagctgaacgggcagccgccggtg
caggtgtacgtgcgtgtgcgcgaagacccgatcatcgtcatgcactcgatcgactccggc
gagcagctgagcgtctcgagcttcgacgagatccgcacgtacgcgacgatgcagaacccg
ttctcgatcccgaaggctgcgcttgcgctgtgcgggttcttgcccgagttctgcgcgacg
gagtacgcgacgctgcgggagcagctggctgcgcggtttggcggccacgggctggagatc
tcgctgtttgtggcgatcccgacggggtccgggctgggcacgagctccatcgttgccggc
accgtgctgcggtcgctggcggagttctgcaagctgccgtgggacaaccacgatgtgtgc
cgccgcgtgctgctgattgagcagatgctgactgctggtggcgggtggcaggatcagtac
ggcggcctgttcgagggcctgaagcttgtgcagtgcgtgcctgggctgccgtgcctgccg
acggtgcgctggatgccggacagcgtgtacacggacccgaggttcgccgcgtgccacctg
ctgtactacacgggcatcactcgcatggcaaagagcattctcggcgagattgtgcgcgat
gtctttctgaacaatggcgcgacactgcagctgctgcgtgagatgggtgggcccaccact
gccgcgatgtacgacgcgatcacggcgggcaactacaagggctacgcgcggcttgtgcac
cggacgtgggagcagaagaagcggctggacgacggcgtgtgcaaccctgccgtgcagtcg
atcgtggacgttgtggagccgtacgtgtggggtctgacgctgcccggcgctggcggtggc
ggctacatgtacatgtgcgcgaaggacgaggcgtgcgctcgccggatccgcgagctgctg
acggcgaacccgccgaacggcaatgcccgcttcgtggagatgagcgtgtcggcgtctggc
ctccagatcagtcggtcttag

DBGET integrated database retrieval system