KEGG   Leishmania donovani: LDBPK_230050
Entry
LDBPK_230050      CDS       T02289                                 

Name
(RefSeq) peroxidoxin
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
ldo  Leishmania donovani
Pathway
ldo00480  Glutathione metabolism
ldo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LDBPK_230050
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     LDBPK_230050
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC EIAV_GP90
Other DBs
NCBI-GeneID: 13389630
NCBI-ProteinID: XP_003860906
UniProt: A0A3Q8IFP4 E9BG25
Position
23:11109..11789
AA seq 226 aa
MLRRLPTSCFLKRSQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKEINM
NDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTP
RKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGR
NVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM
NT seq 681 nt   +upstreamnt  +downstreamnt
atgctccgccgtcttcccaccagctgcttcctgaagcgctcgcagttccgcgggttcgcg
gctacgtcgccgcttttgaatctggactatcagatgtaccgtacagcgactgtccgtgaa
gctgcgccacagttttccggccaggctgtcgtgaatggtgcaattaaggagataaacatg
aacgactacaagggcaagtacattgtgctgtttttctatccgatggacttcaccttcgtt
tgcccgaccgagatcattgcgttttcggatcgccacgccgactttgagaagctaaacacg
caggttgttgcggtgtcgtgcgattcggtgtactctcacctggcgtgggtgaacacgcca
cgcaaaaagggtggcctcggtgaaatgcacatccccgtactggcggacaagtcgatggag
atcgctcgtgactatggtgtgctgatcgaggaatccggtatcgctcttcgagggctcttt
atcatcgacaagaagggcatcctgcgccactcaacgataaatgaccttcctgtgggccgc
aacgtggacgaggcactgcgcgtgctggaggctttccagtacgcggacgagaatggagat
gcgatcccgtgcggatggaagcctggacagcccacgctggacaccacaaaagcaggcgag
tttttcgagaagaacatgtga

DBGET integrated database retrieval system