KEGG   Leifsonia sp. PS1209: HF024_18500
Entry
HF024_18500       CDS       T06547                                 

Name
(GenBank) glycoside hydrolase family 15
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
leif  Leifsonia sp. PS1209
Brite
KEGG Orthology (KO) [BR:leif00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HF024_18500
Enzymes [BR:leif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     HF024_18500
SSDB
Motif
Pfam: Glyco_hydro_15
Other DBs
NCBI-ProteinID: QJA00296
UniProt: A0A6H1WB48
Position
complement(3862794..3863963)
AA seq 389 aa
MPTTFTPQTALAGIADLAASGHRLIAALQTPEGAYPASPTFSAYAGYCWFRDGSFIADGV
SSYGDEASATAFFDWCARVLTARADHIHWIVNETRAGRPPAGEHMLPARFTYDGQDGTDE
WWDFQLDGYGTWLWALVAHAERHGVDLSGWREAAELTVDYLTSSWDRPCYDWWEEHSESV
HVSTLACVSAGLDAAVRAGLVSGTRAEEATAASRAIREVVAERGVRDGHLTKWLGVATVD
GSLAAAIAPLGMLDARSALAAATIDALERQLTVDGGVHRYLGDTFYGGGRWPILSCFLGL
AHAAAGERERAAELLAWAASTATADLDLPEQVDGHLIAPGMRQEWLDRWGAVATPLLWSH
AMLIRLAVELDPTLTSLTSLTSLPEGPTR
NT seq 1170 nt   +upstreamnt  +downstreamnt
gtgcccaccaccttcaccccgcagaccgcgctcgccgggatcgcggacctcgccgcctcc
ggccaccgcctgatcgcggcgctgcagacgccggaaggcgcatacccggcgagtcccacg
ttctccgcatacgccggatactgctggttccgcgacggatcgttcatcgcggatggcgtc
tcctcctacggcgacgaggcatcggcgacggccttcttcgactggtgcgcgcgggtgctc
acggcgcgggcggaccacatccactggatcgtcaacgagaccagggcaggacgaccgccg
gccggggagcacatgcttcccgcgcggttcacgtacgacggccaggacggcaccgacgag
tggtgggacttccagctcgacggttacggcacctggctgtgggcgctcgtcgcccacgcc
gagcggcacggcgtcgacctctccggctggcgcgaagcggccgagctgacggtcgactac
ctcaccagctcctgggaccgcccgtgctacgactggtgggaggagcacagcgagtccgtg
cacgtctccacgctggcctgcgtctcggccgggttggacgccgcggtgcgcgccggcctg
gtgagcggcacgcgcgccgaggaggcgacggccgcatcccgggccatccgcgaggtcgtc
gctgagcggggcgtgcgcgacggccacctgaccaaatggctcggcgtcgccaccgtcgac
ggcagccttgcagcagccatcgccccgctcgggatgctggacgcgcgctcggcgctcgcc
gctgcaaccatcgacgccctggagcggcagctcacggtcgacggcggcgtgcaccgctac
ctcggcgacaccttctacggcggaggccgctggcccatcctcagctgcttcctcggcctg
gcgcacgccgcggcgggcgagcgggagcgcgcggcggaactgctcgcgtgggcggcatcg
acggccaccgccgacctcgacctccccgagcaggtcgacggccacctgatcgcccccggc
atgcgccaggagtggctcgaccgctggggcgccgtcgccaccccgctgctgtggagccac
gccatgctcatccgtctcgccgtcgaactcgacccgactctcacctcgcttacgtcgctc
acgtcgctcccggaaggacccacccgatga

DBGET integrated database retrieval system