Leifsonia sp. ZF2019: IT072_00070 Help Entry IT072_00070       CDS       T10186                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism leiz  Leifsonia sp. ZF2019 Brite KEGG Orthology (KO) [BR:leiz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:leiz03400]     IT072_00070 Enzymes [BR:leiz01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      IT072_00070 DNA repair and recombination proteins [BR:leiz03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     IT072_00070  Prokaryotic type     IT072_00070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Motif Other DBs NCBI-ProteinID:  UAJ79550 UniProt:  A0A9E6X2C2 Position 12901..13317 Genome browser AA seq 138 aa AA seqDB search MDIRVAAYGVIVDDGRILLAHWNEGGRSGWTLPGGGIDPGEDPVDAVVREIAEETGYAAD AGDLLGIDSKVVPAEQRFTPDAGPLHALRIVYRATVVGGTLANERDGSTDEAAWFRLDAI PNRRVDLVDVALGLAGLR NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggatatcagggtcgccgcgtacggcgtcatcgtggacgacggtcgcatcctgctcgcc cactggaacgaaggcggacgttcgggatggacgctgccgggcggcggcatcgatcccggt gaggatccggtggatgccgtcgtgcgtgagatcgcggaggagaccggctatgcggcggac gccggagatctgctcggcatcgattccaaggtggtcccggcggagcagcggttcacaccg gacgccggaccattgcatgcgctgcgcatcgtctaccgggcaacggtcgtgggcggcacg ctggcgaacgagcgggacgggtcgacggacgaggcggcgtggttccggctcgacgccatc ccgaaccggcgggtcgatctcgtcgacgtggcgctcggcctggccggcctgcgctga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system