KEGG   Lodderomyces elongisporus: LELG_04689
Entry
LELG_04689        CDS       T01116                                 

Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
lel  Lodderomyces elongisporus
Pathway
lel03440  Homologous recombination
lel03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lel00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LELG_04689
   03450 Non-homologous end-joining
    LELG_04689
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lel03400]
    LELG_04689
DNA repair and recombination proteins [BR:lel03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     LELG_04689
   NHEJ (non-homologous end-joining)
    MRX complex
     LELG_04689
SSDB
Motif
Pfam: ETRAMP
Other DBs
NCBI-GeneID: 5230923
NCBI-ProteinID: XP_001523877
UniProt: A5E500
AA seq 756 aa
MNLPFLFFFFHILNLLFFLHCCCCCTNFAILDTRVLLLGKNYTVGRDNDAHFEKFGEDLD
FLFHSGRVAKEYLTIAVGTTLHGNINLKTTLQLCIKSRAKAYINGEIYRLKQKGDPKQDI
DFTNESRIVIASEKDLKNNIVDEPLIIEWVDLRLYIGTRDKFVEQLIHLQLDIRFVDDIK
QATHYYTNKTVPDLDEFRVAIIKGTNIVNEAWIRSLLEDADKLVWLNLKNNLEFLPNGDS
RYLLQLNRVKTLENHKVISFEKISWLDTIIVSRSKEVIEHEVGENEFILVAPSSEFGFEA
IEQNILFNRILTNQLDQVPRNKVTLASLKRPATTSPEKRKRRKYEKVDKLHFFSLGDVTP
VQSIPKEKDDEEEIENEREKAKEKGNEMDAEEGKEIKEKENGKEKNDSVEVQKKQRHETN
NSESIEYNSKTLNELDSITIKNTSNTTSSITNTATNELKKPSIVVKREELSPKLPNLDNG
NNSVSSKKRKNEYNSTTENAPKIAKFVPKVSLIDAVIQAKEQAVKTLNKELGVSDDFYER
KDETEGDDEQTLLAIKKLSNLAIVEVVDKPLRQRPAVPIKVSSTQKNFKRFRKNKPPKSK
IERPQIEMINVGAFSPVKSKKKVTVDSEFNGIMSSVRGFTPSTLFVQDDESGAESSEEKE
RGEDCEQVAPSFQEIKDYSRSQRESQARSHSRNGSRGQPVRRGLTSQRGWGNISESVNEE
KQEQEQEQEKEKEDDIDEDDDGDDDDEEQPKFGFTN
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgaatttaccatttcttttttttttttttcatattctaaatttacttttttttttacat
tgttgttgctgttgtactaactttgcaattttagacacgagagtgctcttactggggaag
aattatacagttggccgtgataatgatgcccactttgaaaaattcggagaagatttggat
ttcttatttcactctggacgagtagcaaaagagtatttaacgatagcagttggtactact
ttgcatggcaatatcaatctgaaaactacattgcagttgtgtataaagtctagggcaaaa
gcatacataaatggggaaatttacagattaaaacaaaaaggagaccccaagcaagatatt
gactttaccaatgaatcaagaattgtgattgcttctgaaaaagacctgaaaaataatata
gtagacgagccgttaattattgaatgggtcgatcttagattgtatatagggacaagagac
aaatttgtggaacaattgatccatctgcaactcgatatacgctttgttgatgacatcaaa
caagcaacacattactataccaacaaaaccgttcctgacctggatgagtttcgcgtggct
ataattaaagggactaatattgtcaatgaagcttggataagatcattactagaggatgca
gataaattggtatggttaaacctcaaaaataatcttgaatttttacccaatggggattcg
cgatatttgctgcagctcaatagagtgaagactttggagaatcacaaggtaatatcattt
gaaaaaatttcgtggttggatactataattgttagtcgttcaaaggaggtgattgagcac
gaagtcggtgaaaatgaatttatattggttgcgccatctagcgagtttggttttgaggca
attgagcaaaacattcttttcaacaggattttgacaaaccaactcgaccaagtaccacga
aataaagtgactttagcgtcattgaaaagaccggccacaacatcgcctgaaaagaggaag
cgacgaaagtatgagaaagtggataaactacattttttttcacttggcgatgtcacacca
gtccaaagtataccgaaagaaaaagatgacgaagaggagatagaaaatgaaagagaaaaa
gcaaaggaaaagggaaatgaaatggatgcagaagagggaaaggaaataaaggaaaaggaa
aacggaaaggaaaaaaacgattcagttgaagtacagaaaaaacagaggcacgaaacaaac
aattcagaatcaattgaatacaactctaaaactttgaatgaattagattccataaccatt
aaaaacactagtaataccacttccagtattactaacaccgcaacgaatgaactgaagaag
ccgagcatcgtggtgaagagggaagaattgtcaccaaagctgcccaatttggataatgga
aataattcggtaagcagtaagaaacgaaaaaatgaatacaatagcactacagaaaacgct
ccaaagattgccaaatttgttcccaaggtatccttaattgatgctgttatacaagcaaaa
gagcaagcagttaaaacgttgaataaggaattgggggtatcggatgatttctacgagaga
aaagatgaaactgaaggggatgacgagcaaacgttgctggcaataaaaaagttgtcaaat
ttggcaatagtagaagtagttgataaaccgttgagacagcgacctgcagtaccaataaag
gttagttcaacacaaaagaatttcaaaaggtttcgcaagaacaaacctccaaaatcgaaa
atagagcgaccgcaaattgaaatgataaatgttggagcttttagtccagtcaagagcaag
aagaaagtgactgtagactcagaattcaatggcataatgagcagtgttcgaggctttact
ccatcaacgttgtttgtacaggacgatgagagtggtgcagaaagtagtgaagaaaaagaa
agaggagaagactgcgaacaagttgcaccatctttccaggaaataaaggattattctcga
agccagagggagagtcaggcgaggagtcatagtagaaatggttcaagaggacaaccagtg
agacggggtttaacgagtcaaagaggttggggtaatatcagtgaaagtgtaaatgaagaa
aagcaagaacaagaacaagaacaagaaaaagaaaaagaggatgatattgatgaggatgat
gacggagacgatgatgacgaagagcagccaaaatttggcttcacaaactaa

DBGET integrated database retrieval system