KEGG   Lodderomyces elongisporus: LELG_05161
Entry
LELG_05161        CDS       T01116                                 
Name
(RefSeq) hypothetical protein
  KO
K19654  2-dehydropantolactone reductase [EC:1.1.1.358]
Organism
lel  Lodderomyces elongisporus
Brite
KEGG Orthology (KO) [BR:lel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LELG_05161
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.358  2-dehydropantolactone reductase
     LELG_05161
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 5230694
NCBI-ProteinID: XP_001523745
UniProt: A5E6C2
AA seq 310 aa
MTYSQSHPVQLHPQFKTKSGQPLSMGTGTGTKWKKDQDKSDINEELVEQLLLSLKLGYRH
IDTAEVYNTHKEVGEALKRTDIPREDLWITTKYNGGWGQHKGSESPEKSIELALKDLGVE
YIDLFLIHSPFFSTDVSNGYTLEDVWKVLIEAKKQGKVREIGISNAAKVHLERLYKVSPS
PEFYPVVNQIEFHAFLQNQSTDIVKYSQEQGILVEAFSPLAPLARVKDGALGGLLKELSS
KYSKTDAQLLLRYVLQKGVLPITTSSKESRIKESLDLFDFELTAEEVQEIDKIGKENPYR
AFFHEQFKDL
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacttattctcaatcacatccagttcaattgcacccacaattcaagactaaatcaggt
caacctctttcaatgggtaccggaacaggtacaaaatggaaaaaggaccaggacaagagc
gatatcaacgaggaacttgttgaacagcttctcttatcattgaaattgggctatagacac
attgacactgctgaagtatacaacacccacaaggaagttggcgaggccctcaagagaact
gatattccaagagaagacttgtggattaccacaaagtataatggtggctggggccaacac
aaaggcagcgagtctcctgagaaatcaattgagctggcattgaaagatttaggagtagaa
tatatcgacttgtttttgattcattcaccattcttcagtactgatgtttctaatggatat
actttggaagatgtatggaaagttcttattgaagccaagaaacagggcaaagtaagggaa
attggtatctcaaatgcagcaaaagtccatttggaacgcttgtacaaggtatcgccaagc
ccagagttttaccccgtggtcaaccagattgaattccacgcttttttgcaaaaccagtca
actgatattgtcaagtactctcaagaacagggtattttagtcgaagcattctctcccttg
gcaccattggctagagtcaaagatggcgcattgggtggcttattaaaagaactttctagc
aaatatagcaagactgatgctcaattattgttgaggtatgttttgcaaaagggagtctta
cccataactacctcctccaaggaaagtagaattaaggagtcacttgacttgtttgacttt
gaattgaccgcggaagaagttcaggaaatcgacaaaattggcaaagagaatccatataga
gcttttttccacgaacagtttaaagatttatag

DBGET integrated database retrieval system