KEGG   Laceyella sacchari: C1X05_07900
Entry
C1X05_07900       CDS       T05304                                 
Name
(GenBank) hypothetical protein
Organism
lfb  Laceyella sacchari
SSDB
Motif
Pfam: DUF2606 Big_1 MG4 DUF6491
Other DBs
NCBI-ProteinID: AUS08775
UniProt: A0A2I7SS90
Position
1549086..1549487
AA seq 133 aa
MHAIVRLYIFIKLKYRCFIERRSKLRILAGILACFILAGCAHEESKQPKLSPVTIRVLDQ
EGKPVSRIAVGIEAVIPEEERDSVGAIPKAGLTNENGEIKDQLVPGKKYIIQLGSKKKEV
VITDKPMIVELTK
NT seq 402 nt   +upstreamnt  +downstreamnt
atgcatgctatagtaagattatatatatttataaaattaaaatacaggtgttttatagaa
aggagatcgaaattgcgaatcttagctggtatccttgcttgcttcatattagcgggttgt
gcccatgaagaaagtaagcaacctaagttaagtcctgttactattcgcgttctggatcaa
gaagggaagcccgtttctagaatagcagtcggcattgaagcggttattcctgaagaagaa
agggatagtgtaggtgcaatacctaaagcaggattaaccaatgaaaatggagagataaaa
gatcagctagtaccaggaaaaaaatatatcatacagttaggaagcaagaaaaaggaagtg
gttattactgataagccgatgatcgttgaacttacgaagtaa

DBGET integrated database retrieval system