KEGG   Limosilactobacillus frumenti: LF145_04645
Entry
LF145_04645       CDS       T06870                                 

Name
(GenBank) glycoside hydrolase 68 family protein
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lfn  Limosilactobacillus frumenti
Pathway
lfn00500  Starch and sucrose metabolism
lfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LF145_04645
Enzymes [BR:lfn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LF145_04645
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor
Other DBs
NCBI-ProteinID: QFG73423
Position
complement(956718..958955)
AA seq 745 aa
MYKVGKKWVVATIVSTSVLMGGVVSAHADQVTTNSDNAVVTNTASQPTGSSSDVTSNTST
SPSTITGAVQVQLKQSTNVDTVPSENNQKKLNPSAAQAVNNAHINVNNLTEDQINELNKI
NFSKSAEKGAKLTFKDLEGIGNAIVKQDPRYTVPYFNAKEINNMPAAYAVDAQTGKMAHL
DVWDSWPVQDAVTGYVSNYKGYQLVIAMMGIPNTPYGDNHIYLLYNKYGDNDFSHWRNAG
SIFGNKENNVYQEWSGSAIVNNDGSIQLFYTSNDTSDFKLNDQKLATATLHLNVDDNGVS
IASVDNNHVIFEGDGYHYQTYQQFAEGKDRKDDDYCLRDPHVVQLTNGDRYLVFEANTGK
EDYQSDEQIYNWANYGGDDAFNIKSFFKLLNNKKDRELAGLANGSLGILKLNNNQDNPEV
DEVYSPLVSTLMASDEVERPDIVKLGGKYYLFSVTRVSRGSDTELTQKDNATVGDNVAMI
GYVADNLMGPYKPLNNSGVVLTASVPANWRTATYSYFAVPVEGHPDQVLITSYMSNKDFA
SGKGNYATWAPSFLVQINSDNTTMVLARATNQGDWIWDNSSRNDKMLGVLDKNAANSAAL
PGEWGKPVDWSLINRSAGLGLKPHQGADPSEQPNNKPGTNPGNKPGTNPDNKPGDKPGTN
PDNKPGDKPGTNPDNIPGNNPGLNPRETPNEVPGKSKMPGMTSDQKQSENKQLLPQTGNG
NGLMALFAGSLLAMFGIATVEKQHN
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgtataaagttggtaaaaagtgggtagttgctactatagtatctacttctgtgctgatg
ggtggggtagttagtgcccatgccgaccaagttactactaatagtgataatgctgttgtg
accaatactgctagtcaacctactgggtccagctctgatgtaacaagtaacaccagcact
agccctagtacaattactggtgccgttcaagttcaattaaaacaaagcactaatgttgat
acagtacctagtgaaaacaatcaaaaaaagttgaacccctctgctgctcaggctgttaac
aatgcgcatattaatgttaataacttgacagaagaccaaattaatgagctgaataagatt
aatttctcgaagtctgctgaaaaaggtgctaagttaaccttcaaagatttagaaggcatt
ggcaatgcaattgttaagcaagatccacggtatacagttccttattttaacgctaaggaa
attaataatatgccagctgcttatgctgtggatgcacaaacgggtaaaatggcgcacctt
gacgtgtgggattcctggccagtacaagatgctgttacaggatatgtttcaaattacaag
ggctaccagctagtaatcgctatgatggggattcctaatacaccctatggcgacaaccat
atttatctcttgtacaacaagtatggtgacaatgacttctcacactggcgtaatgcgggt
tcaatctttggtaacaaagaaaacaatgtctaccaagaatggtcgggttctgccattgtg
aacaacgatggttcaattcaattattctatacttctaatgatacttctgattttaagtta
aatgatcaaaagctggctacagctaccctgcacttaaacgttgatgataatggggtatca
atcgctagtgttgataataatcatgttatctttgaaggtgatggctatcattaccagacc
taccaacaatttgccgagggaaaagatcgtaaagatgatgattactgcttgcgcgatcca
catgtagtgcaattaacaaatggtgatcgctacttagtatttgaagccaatactggtaaa
gaagattaccaaagtgatgagcaaatttataactgggctaattacggtggcgatgatgcc
tttaatattaagagcttctttaaacttttaaataacaagaaagatcgtgaattagctgga
ctagccaatggctcgctagggatcttgaaattaaataacaatcaagacaatccagaggta
gatgaagtctactcaccactagtatctacattgatggcaagtgatgaagttgaacggccg
gatattgtaaaacttggtggtaaatattatcttttctccgtaacgcgtgttagtcgggga
tcagatactgaactgactcaaaaagataatgcaactgtcggggacaatgtcgccatgatc
ggttatgttgcggataatttaatgggtccttacaagccattaaacaactctggggttgta
ttgactgcttctgttcctgctaattggcgaaccgccacttattcatacttcgctgtacca
gttgaaggacacccagatcaagttctgattacttcatatatgagtaacaaagattttgct
tctggtaaaggtaattatgctacctgggcacctagtttcttggttcaaattaattcagac
aatactacaatggtattggcacgagctactaatcagggtgattggatttgggataattca
agccgcaatgataaaatgctcggtgtgcttgataagaatgctgctaacagtgctgcttta
ccgggtgaatggggcaagccagttgattggagtttaattaaccgaagtgctggtttggga
ttaaagcctcatcagggagctgatccatcagagcaaccaaataataaaccgggtactaat
ccaggcaataagccgggtactaaccctgacaacaaaccaggtgataagccaggtactaac
cctgacaacaaaccaggtgataagccaggtactaatcctgataatattcccggaaataat
ccaggactaaaccctcgtgaaacccctaatgaggtaccaggcaaatcaaagatgcctggt
atgaccagtgatcaaaaacaatcagagaataaacaactgttgccgcaaactggtaatgga
aatggattaatggctttatttgccggatcacttttggcaatgtttggtattgctactgtt
gaaaagcaacataattag

DBGET integrated database retrieval system