Lachnoanaerobaculum gingivalis: QJR73_10390 Help Entry QJR73_10390       CDS       T09491                                  Name (GenBank) chorismate mutase   KO K04516   chorismate mutase [EC:5.4.99.5] Organism lgg  Lachnoanaerobaculum gingivalis Pathway lgg00400   Phenylalanine, tyrosine and tryptophan biosynthesis lgg01100   Metabolic pathways lgg01110   Biosynthesis of secondary metabolites lgg01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:lgg00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     QJR73_10390 Enzymes [BR:lgg01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      QJR73_10390 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CM_2 SBP_bac_3 RON4 Bact_A2M_1st aL49 Osmo_CC Motif Other DBs NCBI-ProteinID:  WHE86682 Position 2213095..2213373 Genome browser AA seq 92 aa AA seqDB search MNELENLREKIDTIDKEMIALFEKRMDVVADIAAYKIKNNLPVLNQNREDIVVSKVKSTV KNKDYADSAADLIKDIMEISKKFQQKLISKQQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacgaattagaaaatctgcgtgaaaaaattgatactatagacaaggaaatgatagcc ctctttgaaaaaagaatggatgtagtagccgatattgcagcctacaaaataaaaaataat ctccctgttctaaatcaaaaccgagaggatatcgttgtatcaaaagtaaaatctaccgta aaaaataaggactacgcagacagtgctgccgatctcatcaaagatatcatggaaatcagc aaaaaattccagcaaaagcttatctcaaagcaacaataa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (6) Pfam (6) All databases (7) Download RDF

DBGET integrated database retrieval system