KEGG   Leishmania infantum: LINJ_23_0050
Entry
LINJ_23_0050      CDS       T01112                                 

Name
(RefSeq) peroxidoxin
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
lif  Leishmania infantum
Pathway
lif00480  Glutathione metabolism
lif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LINJ_23_0050
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     LINJ_23_0050
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 5069103
NCBI-ProteinID: XP_001465682
UniProt: Q95U89
Structure
Position
23:16567..17247
AA seq 226 aa
MLRRLPTSCFLKRSQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKDINM
NDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTP
RKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGR
NVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM
NT seq 681 nt   +upstreamnt  +downstreamnt
atgctccgccgtcttcccaccagctgcttcctgaagcgctcgcagttccgcgggttcgcg
gctacgtcgccgcttttgaatctggactatcagatgtaccgtacagcgactgtccgtgaa
gctgcgccacagttttccggccaggctgtcgtgaatggtgcaattaaggatataaacatg
aacgactacaagggcaagtacattgtgctgtttttctatccgatggacttcaccttcgtt
tgcccgaccgagatcattgcgttttcggatcgccacgccgactttgagaagctaaacacg
caggttgttgcggtgtcgtgcgattcggtgtactctcacctggcgtgggtgaacacgcca
cgcaaaaagggtggcctcggtgaaatgcacatccccgtactggcggacaagtcgatggag
atcgctcgtgactatggtgtgctgatcgaggaatccggtatcgctcttcgagggctcttt
atcatcgacaagaagggcatcctgcgccactcaacgataaatgaccttcctgtgggccgc
aacgtggacgaggcactgcgcgtgctggaggctttccagtacgcggacgagaatggagat
gcgatcccgtgcggatggaagcctggacagcccacgctggacaccacaaaagcaggcgag
tttttcgagaagaacatgtga

DBGET integrated database retrieval system