KEGG   Lotus japonicus: Lj0g3v0306569.1
Entry
Lj0g3v0306569.1   CDS       T04348                                 

Symbol
Lj0g3v0306569.1
Name
(Kazusa) -
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Lj0g3v0306569.1 (Lj0g3v0306569.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     Lj0g3v0306569.1 (Lj0g3v0306569.1)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth DUF4093
AA seq 519 aa
MDVVYVKQELILKEAKDVYKNLIREDPMEGLYMTDIIQRLGIEHLFEEEIEAALRNQHLI
LSSHPSDFVTSHDLYEVALTFRLLRQGGHYCNEDMFDSLKCNKRKLRENHGEDVRGLIAL
YEASQLCIKGEDGLQDAGYLGCELLHAWLSRHEDHGEAKYVANTLQHPLHYGLSRFMDKS
IFLNDFKAKNECSFLEELAKINDSILRFMNKNEIIEVSKWWKELGLCEDVKFARYQPLKW
YMWPMACFTDPRYSDQRIALTKPISLIYIIDDIFDVHGTLDQLTVFTDAVNRWELTGTEQ
LPDFMKNCLISLYDITNDLAENVNKKYGFNPKDTFKKSWMRLLNAFLKEAHWLNSGHLPK
AEDYLNNGIVSTGVHVVLIHAFFLLDNAITKENAAIMNDNFPNIIYSVAKILRLSDDLEG
AKSEDQNGLDGSYLDCYMSEHQDISAEDAQRHVAHLISNEWKHLNREILTPNQFTASFKT
FCLNAARMVPLMYHYRTNPSLFNLKEHVKSLVNVGVGHK
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggatgttgtctatgtcaaacaagaactgattttgaaggaagcaaaggatgtgtacaag
aatcttatcagggaggatccgatggaaggtctgtatatgactgacattatccaaaggctt
ggcattgaacacctctttgaagaggaaattgaagcagctcttagaaatcaacatttgata
ttgagcagccatcccagtgattttgtcactagccatgatctgtatgaagttgcccttaca
ttccgcttgctcagacaaggaggccattactgcaatgaagatatgtttgatagcttgaag
tgtaacaaaagaaagttaagagaaaaccatggtgaagatgtgaggggcctcattgctctg
tatgaagcatcccagctatgtattaaaggagaagatggtcttcaagatgcagggtacctc
ggctgtgagctccttcatgcatggctatcaagacatgaagaccatggtgaagctaaatat
gttgcaaacactcttcagcatccgcttcactatggattgtcaagattcatggataaaagc
atcttcctcaatgatttcaaggccaagaacgaatgtagctttttagaggaacttgctaaa
atcaatgacagcatacttagattcatgaacaagaatgaaataattgaagtttccaaatgg
tggaaagagcttggactatgtgaagatgtgaagtttgctaggtatcaacctcttaaatgg
tacatgtggcccatggcatgctttacagatccaaggtattcagaccaaaggattgcgctc
actaaaccaatctctctaatctacattattgatgacattttcgatgttcatgggacatta
gaccagcttacagtgtttacagatgctgttaacaggtgggaattgactggtacagagcaa
cttccagactttatgaaaaattgcttgatttctctttatgacattaccaatgatcttgct
gaaaatgtcaacaaaaagtatgggttcaaccctaaagatacctttaaaaaatcgtggatg
cgattattgaacgctttcttgaaagaggcacattggttgaattctggtcacttgccaaag
gcagaggactacttgaacaatggaattgtgagcacaggagtgcatgtggttcttattcat
gcatttttcctcttggataatgctataactaaggaaaatgcagctatcatgaacgacaac
tttccaaacattatatattccgtcgctaaaattcttcgtctttcagatgatttagaagga
gctaagagtgaagatcaaaatggtcttgatgggtcgtatcttgattgctacatgagtgaa
caccaagacatttcagctgaagatgcacagaggcatgttgcccacttgatttcaaatgaa
tggaaacatctcaatcgagaaatcttgaccccgaatcaatttacagcatcatttaaaacc
ttctgtctcaatgctgctagaatggtacctctcatgtaccattatcgcaccaatccaagc
ctctttaatctgaaggaacatgtcaagtcactggttaatgttggtgttgggcacaagtag

DBGET integrated database retrieval system