KEGG   Lactobacillus johnsonii FI9785: FI9785_1296
Entry
FI9785_1296       CDS       T01120                                 

Symbol
inuJ
Name
(GenBank) inulosucrase InuJ
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00500  Starch and sucrose metabolism
ljf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FI9785_1296 (inuJ)
Enzymes [BR:ljf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     FI9785_1296 (inuJ)
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: CAX67156
UniProt: D0R4Z3
Position
complement(1218026..1220188)
AA seq 720 aa
MLENKNHKKISLSGKSLLMGTLSTAAIILSASTANAATNESNTTASQNQTANINEAPVGS
APVLDTPSSATDTTPGTDLSNNGSESVITDNSKKNDSKKKDTTQDISEKPELKGKIKDIV
KNSGINADDLNSDQINNLNKVTFEGNPEDGTKLTLNDLDVIGQALVERNPKYAVPYFNAK
EIKNMDAAVTKDAQTGKTETLEIWDSWPVQDPITGYVSNYKGYQLVIAMMGMPKKNDNHI
YLLYNKYNDNNFSHWRNAGSIFGYEETPDLQEWSGSAIVNKDDSIQLFYTKNDTSNGKIN
DQQLATANLKLRVDNNGVSIVSVDNDHVIFIGDGKKYQTYDQFANGINRNKDNYTLRDPH
VVEEENGDRYLVFEANTGSDNYQGDNQVYNWTNYGGNDKFNVRNFLDYFDNDNDKALASA
ANGALGILKLSGEQNNPIVEPENVYSPLVTSLMVSDEMERPDVVKVGNKYYLFSATRLSR
GTKGRITQLANKTVGDNVAMIGFVSDHLTHGYVPLNGSGVVLTASVPSNWRTATYSYYAV
PIEGKEDQLLITAYMTNRGEVAGKGNNSTWAPSFLLQLNPDNTTTVLAKLTNQGVWVWND
NSENDNMKGTIKRDSQNSAGLYEEWGKVVDWDVIDKHNLKTQKSANSNPDSSSSAVPEVA
TVSDDQSKSLVKKNTQLNATQSKLPKAGAKNDVAAVILGAVSSMLGAIGLAGASKRKRKN
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgttggaaaataaaaatcataaaaagatatctttaagcggaaaatctttgttaatggga
accttgtcaacagcagcaattatattaagtgcatcaactgcaaatgctgcgactaatgaa
agtaatactacagctagtcagaatcaaacagcaaatatcaacgaagcaccagtaggtagt
gccccagtcttagataccccttcttcggctacggatactacacctgggacagatttaagt
aataatggttcggagtcagtaattaccgataattccaagaagaatgattctaaaaaaaag
gatacaacacaagatatttctgaaaaacctgagttaaaaggaaaaataaaagatattgtt
aaaaattctggtataaatgcggatgatctaaacagtgatcaaattaataatctaaataaa
gttacatttgaagggaatccagaagacggaactaaattaacgctaaatgatttagacgta
atcggacaagctcttgttgaaagaaatcctaaatatgcagttccatatttcaatgccaag
gaaataaagaatatggatgctgcggtaactaaagatgcgcagaccggtaaaactgaaaca
ttggaaatatgggattcatggccagttcaagatcctataactggatatgtatcaaattat
aaaggatatcaacttgttattgccatgatggggatgcctaaaaagaacgataatcatatt
tatcttttatataataaatataatgacaataatttctcgcattggcgtaatgctggatct
atctttggttatgaagaaactccagatttacaagaatggtctggatcagctattgtaaat
aaagatgactctattcaactcttttatactaagaatgatacttcaaatggtaaaattaat
gaccaacaattagctacggctaatctaaaattaagagttgataataatggtgtttctatc
gttagtgtcgacaatgatcatgtgatttttattggtgatggcaaaaagtatcaaacttat
gatcaatttgcaaatggcattaatagaaataaggataattatactttacgtgatccacat
gtggttgaagaagaaaatggtgatcgttatctagtatttgaagcaaatactggaagtgat
aattatcaaggagataatcaagtttataactggaccaattatggtggtaatgataagttc
aacgtccgtaatttcttagattattttgataatgataacgataaagcactcgcaagtgca
gctaatggtgctttaggtattttgaagttaagtggagaacaaaataatccaattgttgag
ccagaaaatgtgtactctcctttagtaacttcattaatggtcagtgatgaaatggaaaga
cctgacgttgtcaaagttggaaataaatattatttattttcagctacaagattatctcga
ggaactaaaggacggattacgcaacttgctaataagactgttggagataacgttgctatg
attggatttgtttctgatcatttgacacacggatatgttcctttaaatggttctggtgtt
gttttaactgcttctgttccatcaaattggcgtacagctacttattcttattatgcagtt
cctattgaaggaaaagaagatcaacttttaattactgcatatatgactaatcgtggtgaa
gttgccggaaagggtaataattctacttgggcaccaagtttcttgttacaacttaatcca
gataatacaactactgttttagctaaacttactaaccagggtgtctgggtttggaatgat
aatagtgaaaacgataatatgaagggaactattaagagagattctcaaaatagtgcaggt
ttgtatgaagaatggggaaaagttgttgattgggatgtaattgataaacataatttgaag
acccaaaaatctgcaaattcaaatccagattcttcttcatcagctgttcctgaagttgcg
actgtttcagatgatcaaagtaagagtttagttaagaagaatacgcaattaaacgctact
caatctaagcttccaaaggctggagctaagaatgatgttgcagcagttattttaggtgct
gtaagttcaatgcttggtgcaattggtttagcaggtgcttcgaagcgcaaacgcaaaaac
taa

DBGET integrated database retrieval system