KEGG   Lactobacillus johnsonii DPC 6026: LJP_1240c
Entry
LJP_1240c         CDS       T01960                                 

Name
(GenBank) Fructosyltransfearse
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00500  Starch and sucrose metabolism
ljh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LJP_1240c
Enzymes [BR:ljh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LJP_1240c
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: AEB93562
UniProt: F4AFU1
Position
complement(1334114..1336351)
AA seq 745 aa
MLENKNHKKISLSGKSLLMGTLSTAAIVLSASTANAATNESNTTASQNQTTSLTNVETKN
TNNSQSIQRNEKVANQAANINEAPVGSALDTPSSATDTTPGTDLSNNGSESVITDNSKKN
NSKKKDTTQDISEKPELKGKIKDIVKNSGINADDLNSDQINNLNKVTFEGNPEDGTKLTL
NDLDVIGQALVERNPKYAVPYFNAKEIKNMDAAVTKDAQTGKTETLEIWDSWPVQDPITG
YVSNYKGYQLVIAMMGMPKKNDNHIYLLYNKYNDNNFSHWRNAGSIFGYEETPDLQEWSG
SAIVNKDDSIQLFYTRNDTSNGKINDQQLATANLKLRVDNNGVSIVSVDNDHVIFIGDSK
KYQTYDQFANGINRNKDNYTLRDPHVVEEENGDRYLVFEANTGSDNYQGDNQVYNWTNYG
GNDKFNVRNFLDYFDNDNDKALASAANGALGILKLSGEQNNPVVEPENVYSPLVTSLMVS
DEMERPDVVKVGNKYYLFSATRLSRGTKGRITQLANKTVGDNVAMIGFVSDHLTHGYVPL
NGSGVVLTASVPSNWRTATYSYYAVPIEGKEDQLLITAYMTNRGEVAGKGNNSTWSPSFL
LQLNPDNTTTVLAKLTNQGVWVWNDNSENDNMKGTIKRDSQNSAGLYEEWGKVVDWDVID
KHNLKTQKSANSNPDSSSSAVPEVATVSDDQSKSLVKKNTQLNATQSKLPKAGAKNDVAA
VILGAVSSMLGAIGLAGASKRKRKN
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgttggaaaataaaaatcataaaaagatatctttaagcggaaaatctttgttaatggga
accttgtcaacagcagcaattgtattaagtgcatcaactgcaaatgctgcgaccaatgaa
agtaatactacagctagtcagaatcaaactacttcactcactaatgtagaaactaaaaat
acaaataatagtcaaagtattcaaagaaatgaaaaagttgctaatcaagcagcaaatatc
aacgaagcaccagtaggtagtgccctagatactccttcttcggctacggatactacacct
gggacagatttaagtaataatggttcggagtcagtaattaccgataattccaagaagaat
aattctaaaaaaaaggatacaacacaagatatttctgaaaaacctgagttaaaaggaaaa
ataaaagatattgttaaaaattctggtataaatgcggatgatctaaacagtgatcaaatt
aataatctaaataaagttacatttgaagggaatccagaagacggaactaaattaacgcta
aatgatttagacgtaatcggacaagctcttgttgaaagaaatcctaaatatgcagttcca
tatttcaatgccaaggaaataaagaatatggatgctgcggtaactaaagatgcgcagacc
ggtaaaactgaaacattggaaatatgggattcatggccagttcaagatcctataactgga
tatgtatcaaattataaaggatatcaacttgttattgccatgatggggatgcctaaaaag
aacgataatcatatttatcttttatataataaatataatgacaataatttctcgcattgg
cgtaatgctggatctatctttggttatgaagaaactccagatttacaagaatggtctgga
tcagctattgtaaataaagatgactctattcaactcttttatactaggaatgatacttca
aatggtaaaattaatgaccaacaattagctacggctaatctaaaattaagagttgataat
aatggtgtttctatcgttagtgtcgacaatgatcatgtaatttttattggtgatagcaaa
aagtatcaaacttatgatcaatttgcaaatggcattaatagaaataaggataattatact
ttacgtgatccacatgtggttgaagaagaaaatggtgatcgttatctagtatttgaagca
aatactggaagtgataattatcaaggagataatcaagtttataactggaccaattatggt
ggtaatgataagttcaacgtccgtaatttcttagattattttgataatgataacgataaa
gcactcgcaagtgcagctaatggtgctttaggtattttgaagttaagtggagaacaaaat
aatccagttgttgagccagaaaatgtgtactctcctttagtaacttcattaatggtcagt
gatgaaatggaaagacctgacgttgtcaaagttggaaataaatattatttattttcagct
acaagattatctcgaggaactaaaggacggattacgcaacttgctaataagactgttgga
gataacgttgctatgattggatttgtttctgatcatttgacacacggatatgttccttta
aatggttctggtgttgttttaactgcttctgttccatcaaattggcgtacagctacttat
tcttattatgcagttcctattgaaggaaaagaagatcaacttttaattactgcatatatg
actaatcgtggtgaagttgccggaaagggtaataattctacttggtcaccaagtttcttg
ttacaacttaatccagataatacaactactgttttagctaaacttactaaccagggtgtc
tgggtttggaatgataatagtgaaaacgataatatgaagggaactattaagagagattct
caaaatagtgcaggtttgtatgaagaatggggaaaagttgttgattgggatgtaattgat
aaacataatttgaagacccaaaaatctgcaaattcaaatccagattcttcttcatcagct
gttcctgaagttgcgactgtttcagatgatcaaagtaagagtttagttaagaagaatact
caattaaacgctactcaatctaagcttccaaaggctggagctaagaatgatgttgcagca
gttattttaggtgctgtaagttcaatgcttggtgcaattggtttagcaggtgcttcaaag
cgcaaacgtaaaaactaa

DBGET integrated database retrieval system