KEGG   Lactobacillus johnsonii N6.2: T285_06195
Entry
T285_06195        CDS       T02941                                 

Name
(GenBank) levansucrase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
ljn  Lactobacillus johnsonii N6.2
Pathway
ljn00500  Starch and sucrose metabolism
ljn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    T285_06195
Enzymes [BR:ljn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     T285_06195
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: AHA97605
UniProt: A0A7D9N6Y6
Structure
PDB: 
2YFR 2YFT 2YFS

Position
complement(1276548..1278959)
AA seq 803 aa
MLENKNHKKISLSGKSLLMGTLSTAAIVLSASTANAATINADNVNENQTVEVTASSVNNE
NNKQVTEKDSADKSTSDVAEDANTKKSNENTETTEKNTQTVVTNAPVSDVKNTNTVTAET
PVDKVVNNSDQKTTNAATTDTKKDDVKQVEKKDSVDKTNAEENKDSSVKPAENATKAELK
GQVKDIVEESGVDTSKLTNDQINELNKINFSKEAKSGTQLTYNDFKKIAKTLIEQDARYA
IPFFNASKIKNMPAAKTLDAQSGKVEDLEIWDSWPVQDAKTGYVSNWNGYQLVIGMMGVP
NVNDNHIYLLYNKYGDNDFNHWKNAGPIFGLGTPVIQQWSGSATLNKDGSIQLYYTKVDT
SDNNTNHQKLASATVYLNLEKDQDKISIAHVDNDHIVFEGDGYHYQTYDQWKETNKGADN
IAMRDAHVIDDDNGNRYLVFEASTGTENYQGDDQIYQWLNYGGTNKDNLGDFFQILSNSD
IKDRAKWSNAAIGIIKLNDDVKNPSVAKVYSPLISAPMVSDEIERPDVVKLGNKYYLFAA
TRLNRGSNDDAWMATNKAVGDNVAMIGYVSDNLTHGYVPLNESGVVLTASVPANWRTATY
SYYAVPVEGRDDQLLITSYITNRGEVAGKGMHATWAPSFLLQINPDNTTTVLAKMTNQGD
WIWDDSSENPDMMGVLEKDAPNSAALPGEWGKPVDWDLIGGYNLKPHQPVTPIPNVPTTP
EAPTTPDKPEVPTTPEVPTTPEVPTTPETPTPEVPKNPVKKTSQSKLPKAGDKNSFAAVV
LGAVSSILGAVGLTGVSKRKRNN
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgttggaaaataaaaatcataaaaagatatctttaagcggaaaatctttgttaatggga
accttgtcaacagcagcaattgtattaagtgcatcaactgcaaatgctgcgactattaat
gcagacaatgttaatgaaaatcaaactgtagaagtaactgctagttcagtaaacaatgaa
aataataagcaagtaactgaaaaagatagtgcagataaaagtactagtgatgtggctgaa
gatgctaacaccaagaaatcaaacgaaaatacagaaactacagaaaagaatactcaaaca
gttgttactaatgcgccagtaagtgatgtgaaaaatacaaacacagttaccgctgaaaca
cctgttgataaagtagtaaataatagtgatcaaaagacaactaatgctgcaactactgat
actaaaaaagatgatgtaaaacaagttgaaaagaaagactcagtagataaaacaaatgct
gaggaaaataaagatagttcagtaaagccagctgaaaatgctactaaggctgaattaaag
ggccaagttaaagatatcgttgaagaatctggtgttgatactagcaagttaactaatgat
caaattaatgaattaaataaaattaatttctccaaagaagcaaaaagtggtactcagtta
acttacaacgactttaaaaaaattgctaaaactttaattgaacaagatgctcgttatgct
attccattcttcaatgcaagtaaaattaaaaatatgcctgctgctaaaacacttgatgct
caaagtggaaaagtagaagatttggaaatttgggattcatggcctgttcaagatgcaaaa
actggttacgtatctaattggaatggctaccaattagtgattggtatgatgggagttcca
aacgtcaatgataaccacatttatcttctttacaacaagtatggtgataatgactttaat
cattggaagaatgccggtcctattttcggtctaggtactccagttattcaacaatggtct
ggatcagcaactttaaataaagatggctcaattcaactttactacactaaggttgatact
agtgataataatactaaccaccaaaaactcgctagtgcaactgtttacttaaatcttgaa
aaagatcaagataagatttctattgctcatgttgacaacgaccatattgtctttgaaggt
gatggttaccactaccaaacttatgaccaatggaaagaaactaacaagggtgctgacaat
atcgcaatgcgtgatgcacacgtgattgatgatgataatggtaatcgttaccttgtgttt
gaagcaagtactggaaccgaaaattatcaaggtgatgatcaaatttatcaatggttaaat
tacggcggtactaacaaggataatttaggtgatttcttccaaattttatctaactccgat
attaaagatagagctaaatggtcaaacgctgcaattggtatcattaaattaaatgatgat
gttaagaatccaagtgttgcaaaggtctacagcccacttattagtgcaccaatggtaagt
gatgaaattgaacgccctgatgttgttaaattaggtaataagtattacttatttgctgct
actagattaaaccgtggtagtaacgatgatgcttggatggcaactaacaaagcagttggt
gataacgtagctatgattggttatgtttctgataacttaactcatggttatgttccattg
aatgaatctggcgttgttttaactgcatctgtgccggctaactggcgtactgcaacttat
tcatactatgcagttccagtagaaggaagagatgatcaacttttaattacttcatacatc
actaatcgtggtgaggttgctggaaagggtatgcatgcaacttgggcaccaagtttcttg
ttacaaattaatccagataacactactactgttttagctaaaatgactaaccaaggggat
tggatttgggatgatagtagtgaaaatccagatatgatgggtgtacttgaaaaagatgct
ccaaatagtgctgcccttcctggagaatggggaaaaccagttgattgggatttaattggt
ggatacaacttgaagccacaccaacctgtaactcctattccaaatgtaccaactactcct
gaagccccaaccacaccagataagccagaagtaccaactacccctgaagtcccaaccact
ccagaggtaccaactactccagaaactccaactccagaagttccaaagaatccagttaag
aaaactagtcagtctaaacttccaaaggcgggagataaaaatagctttgcagcagttgtt
ttaggtgctgtaagttcaatattaggtgctgttggtttaacaggtgtttcaaaacgtaaa
cgcaataattaa

DBGET integrated database retrieval system