KEGG   Lactobacillus johnsonii NCC 533: LJ_0913
Entry
LJ_0913           CDS       T00158                                 

Name
(GenBank) levansucrase precursor
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00500  Starch and sucrose metabolism
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LJ_0913
Enzymes [BR:ljo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LJ_0913
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: AAS08734
UniProt: Q74K42
Structure
PDB: 
2YFR 2YFT 2YFS

Position
813481..815874
AA seq 797 aa
MLENKNHKKISLSGKSLLMGTLSTAAIVLSASTANAATINADNVNENQTVEVTASSVNNE
NNKQVTEKDSADKSTSDVAEDANTKKSNENTETTEKNTQTVVTNAPVSDVKNTNTVTAET
PVDKVVNNSDQKTTNAATTDTKKDDVKQVEKKDSVDKTNAEENKDSSVKPAENATKAELK
GQVKDIVEESGVDTSKLTNDQINELNKINFSKEAKSGTQLTYNDFKKIAKTLIEQDARYA
IPFFNASKIKNMPAAKTLDAQSGKVEDLEIWDSWPVQDAKTGYVSNWNGYQLVIGMMGVP
NVNDNHIYLLYNKYGDNDFNHWKNAGPIFGLGTPVIQQWSGSATLNKDGSIQLYYTKVDT
SDNNTNHQKLASATVYLNLEKDQDKISIAHVDNDHIVFEGDGYHYQTYDQWKETNKGADN
IAMRDAHVIDDDNGNRYLVFEASTGTENYQGDDQIYQWLNYGGTNKDNLGDFFQILSNSD
IKDRAKWSNAAIGIIKLNDDVKNPSVAKVYSPLISAPMVSDEIERPDVVKLGNKYYLFAA
TRLNRGSNDDAWMATNKAVGDNVAMIGYVSDNLTHGYVPLNESGVVLTASVPANWRTATY
SYYAVPVEGRDDQLLITSYITNRGEVAGKGMHATWAPSFLLQINPDNTTTVLAKMTNQGD
WIWDDSSENPDMMGVLEKDAPNSAALPGEWGKPVDWDLIGGYNLKPHQPVTPIPNVPTTP
ETPTTPDKPEVPTTPEVPTTPETPTPEAPKNPVKKTSQSKLPKAGDKNSFAAVVLGAVSS
ILGAVGLTGVSKRKRNN
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgttggaaaataaaaatcataaaaagatatctttaagcggaaaatctttgttaatggga
accttgtcaacagcagcaattgtattaagtgcatcaactgcaaatgctgcgactattaat
gcagacaatgttaatgaaaatcaaactgtagaagtaactgctagttcagtaaacaatgaa
aataataagcaagtaactgaaaaagatagtgcagataaaagtactagtgatgtggctgaa
gatgctaacaccaagaaatcaaacgaaaatacagaaactacagaaaagaatactcaaaca
gttgttactaatgcgccagtaagtgatgtgaaaaatacaaacacagttaccgctgaaaca
cctgttgataaagtagtaaataatagtgatcaaaagacaactaatgctgcaactactgat
actaaaaaagatgatgtaaaacaagttgaaaagaaagactcagtagataaaacaaatgct
gaggaaaataaagatagttcagtaaagccagctgaaaatgctactaaggctgaattaaag
ggccaagttaaagatatcgttgaagaatctggtgttgatactagcaagttaactaatgat
caaattaatgaattaaataaaattaatttctccaaagaagcaaaaagtggtactcagtta
acttacaacgactttaaaaaaattgctaaaactttaattgaacaagatgctcgttatgct
attccattcttcaatgcaagtaaaattaaaaatatgcctgctgctaaaacacttgatgct
caaagtggaaaagtagaagatttggaaatttgggattcatggcctgttcaagatgcaaaa
actggttacgtatctaactggaatggctaccaattagtgattggtatgatgggagttcca
aacgtcaatgataaccacatttatcttctttacaacaagtatggtgataatgactttaat
cattggaagaatgccggtcctattttcggtctaggtactccagttattcaacaatggtct
ggatcagcaactttaaataaagatggctcaattcaactttactacactaaggttgatact
agtgataataatactaaccaccaaaaactcgctagtgcaactgtttacttaaatcttgaa
aaagatcaagataagatttctattgctcatgttgacaacgaccatattgtctttgaaggt
gatggttaccactaccaaacttatgaccaatggaaagaaactaacaagggtgctgacaat
atcgcaatgcgtgatgcacacgtgattgatgatgataatggtaatcgttaccttgtgttt
gaagcaagtactggaaccgaaaattatcaaggtgatgatcaaatttatcaatggttaaat
tacggcggtactaacaaggataatttaggtgatttcttccaaattttatctaactccgat
attaaagatagagctaaatggtcaaacgctgcaattggtatcattaaattaaatgatgat
gttaagaatccaagtgttgcaaaggtctacagcccacttattagtgcaccaatggtaagt
gatgaaattgaacgccctgatgttgttaaattaggtaataagtattacttatttgctgct
actagattaaaccgtggtagtaacgatgatgcttggatggcaactaacaaagcagttggt
gataacgtagctatgattggttatgtttctgataacttaactcatggttatgttccattg
aatgaatctggcgttgttttaactgcatctgtaccggctaactggcgtactgcaacttat
tcatactatgcagttccagtagaaggaagagatgatcaacttttaattacttcatacatc
actaatcgtggtgaggttgctggaaagggtatgcatgcaacttgggcaccaagtttcttg
ttacaaattaatccagataacactactactgttttagctaaaatgactaaccaaggggat
tggatttgggatgatagtagtgaaaatccagatatgatgggtgtacttgaaaaagatgct
ccaaatagtgctgcccttcctggagaatggggaaaaccagttgattgggatttaattggt
ggatacaacttgaagccacaccaacctgtaactcctattccaaatgtaccaactactcct
gaaaccccaaccacaccagataagccagaggtaccaactacccctgaagttccaaccact
ccagaaactccaactccagaagctccaaagaatccagttaagaaaactagtcagtctaaa
cttccaaaggctggagataaaaatagctttgcagcagttgttttaggtgctgtaagttca
atattaggtgctgttggtttaacaggtgtttcaaaacgtaaacgtaataattaa

DBGET integrated database retrieval system