Litorivicinus lipolyticus: GH975_11590 Help Entry GH975_11590       CDS       T06278                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism llp  Litorivicinus lipolyticus Pathway llp02024   Quorum sensing llp03018   RNA degradation Brite KEGG Orthology (KO) [BR:llp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GH975_11590 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GH975_11590 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:llp03019]     GH975_11590 (hfq)    03036 Chromosome and associated proteins [BR:llp03036]     GH975_11590 (hfq) Messenger RNA biogenesis [BR:llp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GH975_11590 (hfq) Chromosome and associated proteins [BR:llp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GH975_11590 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QGG81170 UniProt:  A0A5Q2QH53 Position complement(2267750..2268058) Genome browser AA seq 102 aa AA seqDB search MSKGHSLQDPYLNVLRKERVPVSIFLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAIS TVVPARNVKLPMPGAEDEIDAEEEKPARKFGEHNLKPLDEQE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcactcattacaagacccttacctaaacgtactccgcaaggaacgtgtt ccggtctccatctttttggtcaacggcattaagctgcagggccaaatcgaatctttcgat caattcgttgtgctgcttaaaaataccgtcagccagatggtttataagcacgcgatttcg accgtggtgccggcccgaaacgtcaagctgccgatgcctggcgccgaagacgagatcgac gcggaagaggaaaagcccgcgcgcaagttcggtgaacacaatctgaaaccgctcgacgag caggaataa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system