KEGG   Leishmania major: LMJF_16_0480
Entry
LMJF_16_0480      CDS       T01014                                 

Name
(RefSeq) putative fucose kinase
  KO
K25315  arabinokinase / fucokinase / arabinose-1-phosphate guanylyltransferase / fucose-1-phosphate guanylyltransferase [EC:2.7.1.- 2.7.7.- 2.7.1.52 2.7.7.30]
Organism
lma  Leishmania major
Pathway
lma00520  Amino sugar and nucleotide sugar metabolism
lma01100  Metabolic pathways
lma01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:lma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMJF_16_0480
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     LMJF_16_0480
    2.7.1.-  
     LMJF_16_0480
   2.7.7  Nucleotidyltransferases
    2.7.7.30  fucose-1-phosphate guanylyltransferase
     LMJF_16_0480
    2.7.7.-  
     LMJF_16_0480
SSDB
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 5650593
NCBI-ProteinID: XP_001682126
GeneDB: LmjF.16.0480
UniProt: Q4QEX2
Position
16:complement(168324..171887)
AA seq 1187 aa
MNVSFLFSLPCNLAEFKGAAKLLADAAALPLRECGAKGGVAVPGLFCGCDPEGRPLGSGG
GTVHLLHACYVDEQRHAPASAKRSFLSWLRLADNDGRVIVHAGGLSRRLPAYAAMGKALL
PLPPRRWHRGSQLSRTLLSTQVPMYREIVAMAPARLRTLIACGDVCVDARGALPSLAHFA
DSDVLCFGINADASLFQNHGVLFTARERPLDLDYMLQKPSLDEVRRRVAEGRHSVLLDVG
MWMLSDRAVEVLTRKCLGGALDAEDATDGGYDGHRCTAVRTAYDLYSEFASALGNNAPIA
DPEIAGLKASVVELRDAEFLHYGTNRQLISAVATLQGRESPTPPWSWGTPLDGVLAPERG
GGGEELDFAAGDAMPLLATPSSVIVQNSVVLAPLDGSAAAAAADAPAGAPLSPVRHLWVE
SSWVGARWALRDQHILTGVPRNDWALALPPGACVSVVPVLPAALGGCGDGAVPHAARPYH
MDDAFCGDVRSGSTMYMGVRLHDWLSSRGFSVAELYPAARAADGGAAQPLDMYEAALFPV
CATEQQLGDFLYVATLPLEAATGGCAGVDAARLAAGQAVWRTQPRVSAMDLLRLTDVPAM
LRNSEYYERRMLTLMLALVAGDPAAPRARSPVLPGPMVALLQQQFFLLDLNRVAQRVVEL
GVPLPRHSGPTEWWGGVDAAGNAVALSRQVAPAAPFAKGAAASAGSWAQVFSDEGSPSGG
GRGAPLCTAPGRIVAAHYHAFASRLMELALEAMDAAEPPVSAAEKARRLALLRASSAEEA
RSLVALHDAAALAELRAAIMDSFPDERHDPEMSVHLDQIIWGRCPIRIDVAGAWTDTPPY
AILSGGSVINVAVELNGQPPVQVYVRVREDPIIMMHSIDSGEQLSVSSFDEIRTYATMQN
PFSIPKAALALCGFLPEFCATEYATLREQLAARFGGHGLEISLFVAIPTGSGLGTSSIVA
GTVLRSLAEFCKLPWDNHDVCRRVLLIEQMLTAGGGWQDQYGGLFEGLKLVQCVPGLPCL
PTVRWMPDSVYTDPRFAACHLLYYTGITRMAKGILGEIVRDVLLNNGATLQLLREMGGPT
TAAMYDAITTGNYKGYARLVHRTWEQKKRLDDGVCNPTVQSIVDIVEPYVWGLTLPGAGG
GGYMYMCAKDEACARRIRELLTANPPNGNARFVEMSVSASGLQISRS
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgaacgtgagctttctcttcagcctcccctgcaacctggcggagttcaagggagcggcg
aagctgctggcggacgcggctgcgctccctttgagggagtgcggtgcgaagggcggcgtg
gcggtgcctgggctgttctgtgggtgtgacccggagggcaggccgctgggctccggcggt
ggcacggtgcacctgctgcacgcatgctacgtggacgagcagcgccacgcacctgcgtcc
gcgaagaggtcgttcctgtcgtggctgcggctggcggacaacgatggccgcgtgattgtg
cacgctggcggcctgagccgccgcctgccggcgtacgcggcgatgggcaaggcgctgctg
ccgctgccgccgcgccggtggcaccgtggcagccagctgtctcgcacgctgctctcgacg
caggtgccgatgtaccgggagatagtggcgatggcgcctgcgcgcctgcgcacgctgatt
gcgtgcggcgacgtgtgcgtggatgcgaggggtgcgctgccgtcgctggcgcacttcgcg
gacagtgacgtgctgtgctttggcattaacgcagacgcgagcctctttcagaaccacggc
gtgctcttcactgcacgcgagaggccactcgacctggactacatgttgcagaagccgtcg
ctggatgaggtccgccggcgcgtggcggagggcaggcactcggttcttctggatgtgggc
atgtggatgctgagcgaccgcgcggtggaggtgctgactcgcaagtgtctgggcggagcg
ctggacgcggaggacgcgaccgacggcgggtacgacgggcaccgctgcacggcggtgcgc
accgcgtacgacctgtactcggagttcgcttctgcgctgggcaacaacgcgccgatcgcg
gacccggagatcgcggggctgaaggcgagcgttgtggagctgcgcgacgctgagttcctg
cactacgggacgaaccggcagctgatctcggcggtggcgacgctgcaggggcgcgagtcg
ccgacgccgccgtggtcgtggggcacgccgctcgacggcgtgcttgcgcctgagcgcggc
ggcgggggggaggagctggactttgctgctggcgacgcgatgccgctgcttgcgacgccg
tcgtctgtgattgtgcagaactccgtggtgcttgcgccgctggacgggtccgctgccgcc
gctgctgcggatgcgccggctggtgcgccgctgtcgcctgtgcggcatctgtgggtggag
agcagctgggtgggcgcgcggtgggcgctgcgggaccagcacattctgacgggggtcccg
cgcaacgactgggcgcttgcgctgccgcccggcgcgtgtgtgagcgtcgtgcctgtgctg
cccgctgcgcttggcggctgcggtgacggtgctgtgccgcacgctgcgcggccgtaccac
atggacgacgcgttctgcggcgacgtgcgcagcggctcgacgatgtacatgggtgtgcgc
ctgcacgactggctgtcgagccgcgggttcagcgtagcggagctgtaccccgctgcgcgt
gctgcggacggcggtgctgcgcagccgctggacatgtacgaggctgcgctgttcccggtg
tgcgcgacggagcagcagcttggcgacttcctgtacgttgcgacgctgccgctggaggct
gcgaccggcggctgcgctggcgtggacgctgcgcggcttgccgctgggcaggctgtgtgg
cggacgcagccgcgcgtgtctgcgatggacctgctgcggctgacggacgtgcctgcgatg
ctgcgcaacagcgagtactacgagcggcgcatgctgacgctgatgcttgcgcttgtggcg
ggtgaccccgcggcgccgcgtgcgcggtcgccggtgctgccgggcccgatggttgcgctg
ctgcagcagcagttcttcctgctggacctgaaccgcgtggcccagcgcgtcgtggagctg
ggcgtgccgctgccgcggcacagcgggccgacggagtggtggggcggggtggacgcagct
gggaacgcggtggcgctgtcgcgccaggtggccccggcggcgccgtttgcgaagggcgcg
gctgcgagtgcggggagctgggcgcaggtgttctcggacgagggcagcccgagcggtggc
ggcaggggtgcgccgctgtgcaccgcgcctggccgcatcgtggcggcgcactaccacgcg
tttgcgagccgcctgatggagcttgcgctggaggcgatggatgccgcggagccgccggtg
tctgcggcggagaaggcgcggcgcctcgcgctgctgcgtgcgtcgagcgcggaggaggcc
cgctcgctggtggctctgcacgatgccgccgcgctcgcggagctacgcgcggccatcatg
gactcctttcccgatgagcgccacgacccggagatgagcgtgcaccttgaccaaatcatc
tggggccgctgccccatccgcatcgacgtggcgggggcatggacggatacgccgccatac
gcgatcctgagcggcggcagcgtgatcaacgttgccgtggagctgaacgggcagccgccg
gtgcaggtgtacgtgcgtgtgcgcgaagacccgatcatcatgatgcattcgatcgactcc
ggcgagcagctgagcgtctcgagcttcgacgagatccgcacgtacgcgacgatgcagaac
ccgttctcgatcccgaaggctgcgcttgcgctgtgcgggttcttgcccgagttctgcgcg
acggagtacgcgacgctgcgggagcagttggctgcacggtttggcggccacgggctggag
atctcgctgtttgtggcgatcccgacggggtccgggctgggcacgagctccattgttgcc
ggcaccgtgctgcggtcgctggcggagttctgcaagctgccgtgggacaaccacgatgtg
tgccgccgcgtgctgctgattgagcagatgctgactgctggtggcgggtggcaggatcag
tacggcggcctgttcgagggcctgaagcttgtgcagtgcgtgcctgggctgccgtgcctg
ccgacggtgcgctggatgccggacagcgtgtacacggacccaaggttcgccgcgtgccac
ctgctgtactacacgggcatcactcgcatggcaaagggcattctcggcgagattgtgcgc
gatgtcttgctgaacaatggcgcgacgctgcagctgctgcgtgagatgggtgggcccacc
actgccgcgatgtacgacgcgatcacgacgggcaactacaagggctacgcgcggcttgtg
caccggacgtgggagcagaagaagcggctggacgacggcgtgtgcaaccctaccgtgcag
tcgatcgtggacattgtggagccgtacgtgtggggtttgacgctgcccggcgctggcggt
ggcggctacatgtacatgtgcgcgaaggacgaggcgtgcgctcgccggatccgcgagctg
ctgacggcgaacccgccgaacggcaatgcccgcttcgtggagatgagcgtgtcggcgtcc
ggcctccagatcagccggtcttag

DBGET integrated database retrieval system