KEGG   Leishmania major: LMJF_23_0040
Entry
LMJF_23_0040      CDS       T01014                                 

Name
(RefSeq) peroxidoxin
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
lma  Leishmania major
Pathway
lma00480  Glutathione metabolism
lma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LMJF_23_0040
Enzymes [BR:lma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     LMJF_23_0040
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 5651953
NCBI-ProteinID: XP_001683326
GeneDB: LmjF.23.0040
UniProt: Q4QBH2
Position
23:11076..11756
AA seq 226 aa
MLRRLSTSSFLKRAQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKDINM
NDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTP
RKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGR
NVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAAEFFEKNM
NT seq 681 nt   +upstreamnt  +downstreamnt
atgctccgccgtctttccactagctccttcctgaagcgcgcgcagtttcgcgggttcgcg
gctacgtcgccgcttttgaacctggactatcagatgtaccgtacagcgaccgtccgtgaa
gctgcgccacagttttccggccaggctgtcgtgaatggtgcaattaaggatataaacatg
aacgactacaagggcaagtacattgtgctgtttttctatccgatggacttcaccttcgtt
tgcccgaccgagatcattgcgttttcggatcgccacgccgacttcgagaagctgaacacg
caggttgttgcggtgtcgtgcgattcggtgtactctcacctggcgtgggtgaacacgcca
cgcaaaaagggtggcctcggtgaaatgcacatcccggtactggcggacaaatcgatggaa
atcgctcgtgactacggtgtgctgatcgaagaatccggtatcgctcttcgaggactcttt
atcatcgacaagaagggcatcctgcgccactcgacgatcaatgaccttcctgtgggtcgc
aacgtggacgaggcactgcgcgtgttggaggctttccagtacgcagacgagaacggagac
gcgatcccgtgcggatggaagcctggacagcccacgctggacaccacaaaggcagccgag
tttttcgagaagaacatgtga

DBGET integrated database retrieval system