KEGG   Leishmania mexicana: LMXM_16_0480
Entry
LMXM_16_0480      CDS       T02288                                 

Name
(RefSeq) putative fucose kinase
  KO
K25315  arabinokinase / fucokinase / arabinose-1-phosphate guanylyltransferase / fucose-1-phosphate guanylyltransferase [EC:2.7.1.- 2.7.7.- 2.7.1.52 2.7.7.30]
Organism
lmi  Leishmania mexicana
Pathway
lmi00520  Amino sugar and nucleotide sugar metabolism
lmi01100  Metabolic pathways
lmi01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMXM_16_0480
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     LMXM_16_0480
    2.7.1.-  
     LMXM_16_0480
   2.7.7  Nucleotidyltransferases
    2.7.7.30  fucose-1-phosphate guanylyltransferase
     LMXM_16_0480
    2.7.7.-  
     LMXM_16_0480
SSDB
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 13450329
NCBI-ProteinID: XP_003873733
UniProt: E9AQK6
Position
16:complement(162187..165792)
AA seq 1201 aa
MNVSFLFSLPRTLAEYEGARRLLADAGALSLGEHGAKGGVAVPRLFCGCDPEDKPLGSGG
GTVHLLHACYVDEQRHAPAPAKKSFLSWLRLADTDGRVIVHAGGLSRRLPAYAAVGKALL
PLPPCRWHRGSQLSRTLLSTQVPMYREMVATAPAHLRTLIACGDVCVDARGALPSLAPFA
ESDVLCFGIRADAHVLPSHGVLFTARERPLDLDYMLQKPSLAEVRRRVAGGRHSFLLDVG
MWMLSDRAVEVLARKCLGGALDAEDATGGGRDGHRCTAVRTAYDLYSEFGSALGSHAPSA
DPEIAGLKASVVELRDAEFLHYGTNRQLISAAAALQRREAAAPSWWWGAPFDGVLAPERG
GGEEAGLRAAAADAPAGCAAEELDFAAGDAMPLLATPSSVIVQNSVVLAPLDGSAAAAAA
DAPAGAPLSPVRHLWVESSWVGARWALRDQHILTGIPRNDWALALPPGACVSVVPVLPAA
LGGCGAGTAPHAARAYHMDDAFRGDVRSGATMYMGVRLHDWLSSRGFSVAELYPAARAAG
GGAAPPLDMYEAALFPVCATEQQLGDFLYVATLPLEAATGGCAGVDAARLAAGQAVWRTQ
PRVSAMDLLRLTDVPAMLRNREYYERRMLTLMLALVAADPAAPCARSPVLSGPMIALLQQ
QFFLLDLNRVAQRVVELGVPLPWRSGLTGWCCGVDAAGSAGALSREAAPFAKGAAATAAS
LARMFADEGSVSGGGRGAPLCTVPGRIVVAHYHAFASRLMELALEAMDTAEPPVSAPEKA
RRLALLRAPSVEEARSLAAVHDAAALAELRAAIMDSFPDERHDPEMGVHLDQIIWGRCPI
RIDVAGAWTDTPPYTILSGGSVINVAVELNGQPPVQVYVRVREDPMIVMRSIDSGEQLSV
SSFDEIRTYATMQNPFSIPKAALALCGFLPEFCATEYATLREQLAARFGGHGLEISLFVA
IPTGSGLGTSSIVAGTVLRSLAEFCKLPWDNHDVCRRVLLIEQMLTAGGGWQDQYGGLFE
GLKLVQCVPGLPCLPTVRWMPDSVYTDPRFAACHLLYYTGITRMAKGILGEIVRDVFLNR
GATLQLLREMGGPTTAAMYDAMTTGNYKGYARLVQRTWEQKKRLDDGVCNPAVQSIVDVV
EPYVWGVTLPGAGGGGYMYMCAKDEACARRIRELLTANPPNGNARFVEMSVSASGLQISR
S
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgaacgtgagctttctgttcagcctcccccgcaccctggcggagtacgagggggcgagg
aggctgctggcggacgcgggtgcgctttctttgggggagcacggtgcgaagggcggcgtg
gcggtgcctaggctgttctgcgggtgcgacccggaggacaagccgctgggctccggcggt
ggcacggtgcacctgctgcacgcgtgctacgtggacgagcagcgccacgcacctgcgccc
gcgaagaagtcgttcctgtcgtggctgcggctggcggacaccgatggccgcgtgattgtg
cacgctggcggcctgagccgccgcctgccggcgtacgcggcggtgggcaaggcgctgctg
ccgctgccgccgtgccggtggcaccgtggcagccagctgtctcgcacgctgctctcgacg
caggtgccgatgtaccgggagatggtggcgacggcgccggcgcacctgcgcacgctgatt
gcgtgcggtgacgtgtgcgtggatgcgaggggtgcgctgccgtcgcttgcgccgttcgcg
gagagcgacgtgctgtgctttggcattcgcgccgacgcgcacgtcttgccgagccacggc
gtgctcttcactgcgcgcgagaggccactggacctggactacatgctgcagaagccgtcg
ctggctgaggtgcgccggcgcgtggcggggggcaggcactcgtttctgctggacgtgggg
atgtggatgctgagcgaccgcgcggtggaggtgctggctcgcaagtgtctgggcggagcg
ctggacgcggaggacgcgacgggcggcgggcgcgacgggcaccgctgcacggcggtgcgc
accgcgtacgacctgtactcggagttcggctctgcgctgggcagccacgcgccgagcgcg
gacccggagatcgcggggctgaaggcgagcgttgtggagctgcgcgacgctgagttcctg
cactacgggacgaaccggcagctgatctcggcggcggcggcgctgcagaggcgcgaggcg
gcggcgccgtcgtggtggtggggcgcgccgttcgacggcgtgcttgcgcccgagcgcggc
ggcggggaggaggcggggctgcgtgctgcggcagcggatgcgcctgcgggctgcgcggcg
gaggagctggactttgctgctggcgacgcgatgccgctgctggcgacgccgtcgtctgtg
attgtgcagaactccgtggtgcttgcgccgctggacgggtcggctgcggccgctgctgcg
gatgcgccggctggtgcgccgctgtcgcctgtgcggcacctgtgggtggagagcagctgg
gtgggcgcgcggtgggcgctgcgggaccagcacatcctgacggggatcccgcgcaacgac
tgggcgcttgcgctgccgcccggcgcgtgcgtgagcgttgtgcctgtgctgcccgccgcg
cttggcggctgtggtgccggtaccgcgccgcacgctgcgcgggcgtaccacatggacgac
gcgttccgcggcgacgtgcgcagcggcgcgacgatgtacatgggcgtgcgcctgcacgac
tggctgtcgagccgcgggttcagcgtggcggagctgtaccccgctgcgcgtgctgcgggc
ggcggtgctgcgccgccgctggacatgtacgaggctgcgctgttcccggtgtgcgcgacg
gagcagcagcttggcgacttcctgtacgttgcgacgctgccgctggaggctgcgaccggc
gggtgcgctggcgtggacgctgcgcggcttgccgctgggcaggctgtgtggcggacgcag
ccgcgcgtgtctgcgatggacctgctgcggctgacggacgtgcctgcgatgctgcgcaac
cgcgagtactacgagcggcgcatgctgacgctgatgcttgcgcttgtggctgctgacccc
gcggcgccgtgcgcgcggtcgccggtgctgtcgggcccgatgattgcgctgctgcagcag
cagttcttcctgctggacctgaaccgcgtggcccagcgcgtcgtggagctgggcgtgccg
ctgccgtggcgcagcgggctgacggggtggtgttgcggcgtggacgcagctgggagtgcg
ggagcgctgtcgcgcgaggcggcgccgttcgcgaagggcgcggccgccactgcggccagc
ttggcgcggatgttcgcggacgagggcagcgtgagcggtggcggcaggggtgcgccgctg
tgcaccgtgcctgggcgcatcgtggtggcgcactaccacgcgtttgcgagccgcctgatg
gagctggcgctggaggcgatggatactgcggagccgccggtgtctgcgccggagaaggcg
cggcgcctcgcgctgctgcgtgcgccgagcgtggaggaggcccgctcgctggcggctgtg
cacgatgccgccgcgctcgcggagctacgcgcggccatcatggactcctttcccgatgag
cgccacgacccggagatgggcgtgcaccttgaccaaatcatctggggccgctgccccatc
cggatcgacgtggcgggggcatggacggatacgccgccgtacacgatcctgagcggcggc
agcgtgatcaacgttgccgtggagctgaacgggcagccgccggtgcaggtgtacgtgcgc
gtgcgcgaggacccgatgatcgtcatgcgctcgatcgactccggcgagcagctgagcgtc
tcgagcttcgacgagatccgcacgtacgcgacgatgcagaacccgttctcgatcccgaag
gccgcgcttgcgctgtgcgggttcctgccggagttctgcgcgacggagtacgcgacgctg
cgggagcagctggcggcgcggtttggcggccacgggctggagatctcgctgtttgtggcg
atcccgacggggtctgggctgggcacgagctccatcgttgccggcaccgtgctgcggtca
ctggcggagttctgcaagctgccgtgggacaaccacgatgtgtgccgccgcgtgctgctg
attgagcagatgctgaccgctggtggcgggtggcaggatcagtacggcggcctgttcgag
ggcctgaagcttgtgcagtgcgtgcctgggctgccgtgcctgccgacggtgcgctggatg
ccggacagcgtgtacacggacccgaggttcgccgcgtgccacctgctgtactacacgggc
atcactcgcatggcaaagggcattcttggcgagattgtgcgcgacgtctttctgaaccgt
ggcgcgacactgcagctgctgcgtgagatgggtgggccgacgactgccgcgatgtacgac
gcgatgacgacgggcaactacaagggctacgcgcggcttgtgcagcgcacgtgggagcag
aagaagcggctggacgacggcgtgtgcaaccctgccgtgcagtcgatcgtggacgttgtg
gagccgtacgtgtggggtgtgacgctgcccggcgctggcggcggcggctacatgtacatg
tgcgcgaaggacgaggcgtgcgctcgccggatccgcgagctgctgacggcgaacccgccg
aacggcaatgcccgcttcgtggagatgagcgtgtcggcgtccggcctccagatcagtcgg
tcctag

DBGET integrated database retrieval system