KEGG   Leishmania mexicana: LMXM_23_0040
Entry
LMXM_23_0040      CDS       T02288                                 

Name
(RefSeq) peroxidoxin
  KO
K11186  mitochondrial tryparedoxin peroxidase, trypanosomatid typical 2-Cys peroxiredoxin [EC:1.11.1.-]
Organism
lmi  Leishmania mexicana
Pathway
lmi00480  Glutathione metabolism
lmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LMXM_23_0040
Enzymes [BR:lmi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     LMXM_23_0040
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC AhpC-TSA_2 EIAV_GP90
Other DBs
NCBI-GeneID: 13454439
NCBI-ProteinID: XP_003875626
UniProt: E9AW04
Position
23:11178..11858
AA seq 226 aa
MLRRLSTSCFLKRAQFRGFAATSPLLNMDYQMYRTATVREAAPQFSGQAVVNGAIKEINS
NDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHAEFEKRNTQVIAVSCDSVYSHLAWVNTP
RKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGVLRHATINDLPVGR
NVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM
NT seq 681 nt   +upstreamnt  +downstreamnt
atgctccgccgtctttccacgagctgcttcctgaagcgcgcgcagttccgcgggttcgcg
gctacgtcgccgcttttgaatatggactatcagatgtaccgtacagcgactgtccgtgaa
gctgcgccgcagttttccggtcaggctgttgtgaatggtgcaattaaggaaataaacagc
aacgactacaagggcaaatacattgtgctgtttttctatccgatggacttcaccttcgtt
tgcccgaccgagatcattgcattttcggatcgccacgccgagtttgagaagcgaaatacg
caggtgattgcggtgtcgtgcgattcggtgtactcgcacctggcgtgggtgaacacgcca
cgcaagaagggtggcctcggtgaaatgcacatcccggtactggcggacaagtcgatggag
attgctcgtgactatggtgtgctgatcgaagaatccggtatcgctcttcgaggtctcttt
atcattgacaagaagggcgtcctgcgccacgcaacgatcaatgaccttcctgtgggccgc
aacgtggacgaggcactgcgcgtgctggaggctttccagtatgcggacgaaaacggagac
gcgatcccgtgcggatggaagcctggacagccgacgctggacaccacaaaggcgggcgag
tttttcgagaagaacatgtaa

DBGET integrated database retrieval system