KEGG   Loa loa (eye worm): LOAG_00014
Entry
LOAG_00014        CDS       T02664                                 

Name
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
loa00010  Glycolysis / Gluconeogenesis
loa00030  Pentose phosphate pathway
loa00051  Fructose and mannose metabolism
loa00052  Galactose metabolism
loa01100  Metabolic pathways
loa01200  Carbon metabolism
loa01230  Biosynthesis of amino acids
loa03018  RNA degradation
Module
loa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOAG_00014
   00030 Pentose phosphate pathway
    LOAG_00014
   00051 Fructose and mannose metabolism
    LOAG_00014
   00052 Galactose metabolism
    LOAG_00014
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:loa01009]
    LOAG_00014
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00014
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LOAG_00014
Protein phosphatases and associated proteins [BR:loa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LOAG_00014
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LOAG_00014
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 9937370
NCBI-ProteinID: XP_003135603
UniProt: A0A1S0UCE7
AA seq 784 aa
MNEAEEVISELPDVLASDINSEIEFQIKAVNGHEGSVIKKGKYKGQIMGLFTSGGDAPGM
NSAVRAIVRVGLYLGARVFCIHEGYQGMVDGGKFIREATWETVSDIIQKGGTVIGSARCK
DFRERAGRLKAAENLIRHGITSLVCIGGDGSLTGANTFRNEWSGLVKELLDAKIITTEDA
QKCKLIQIVGIVGSIDNDFCGTDMTIGTDTALHRITEAVDSVRSTAHSHQRCFVVEVMGR
NCGYLALAASLALDADFCFIPEWPPPPHWKSILCKKLKQMREDGNRVNIVIVAEGAIDHN
GTAITSSMIRDVIKKNMKYDTRITILGHIQRGGSPSAFDRLLGCRMGAEATIALMEMNED
SEPCVVSIDGNQMVRIPLMKCVERTKAVKSAMDIKDWALALKLRGRSFRRNVEMYRTLSK
IRKHEPVLEGFNIAIMNVGSPCAGCNAAVMSCVRTAILQGCVPYCIYNSNEGLASGQFQK
MEWNDVALWSAEGGSFLGSQPGLPTNDTLPLMAKNLLNFNIHSLIIIGGFNAYQTCLIFA
QNRENFPSFRIPMCVIPSTINNNVPGTGFTLGADTSLNEICKMIDKIKQSATGSKRRVFI
IETMGSYCGYLATLSAMASGADAAYIYEETFDVHELINDIRVIAEKMKTGAQRYLIVRNE
RASDNYTSEFIRQLFTEEGKGIFTTRTNILGHTQQGGNPSPFDRLFAAKMGARAVVHLLG
QMKEFKKTNLCHPGTATLQGLIGKYVCLTPVEELMEDADFAHRLPVEQWWMKLRQLLRIL
AKHD
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgaatgaggctgaagaagtaatcagtgagttaccggatgtccttgcatccgatatcaat
tcggaaatagaatttcaaattaaagcggtcaacggccatgaaggatctgttatcaagaag
gggaaatacaagggtcaaattatgggcttgttcacgagcgggggtgatgcacctggaatg
aacagtgcggtacgtgcgatagttcgagtaggtctatatcttggtgcacgggtattctgt
attcatgaagggtatcagggcatggttgatggtggaaagtttattagagaggccacctgg
gagacggtttcggatattatccagaaaggtggtacagtgattggttcagcacgttgcaaa
gattttcgggaacgagcaggacgattgaaagcagccgagaatctgattcgacatggtatt
acatcgttggtttgcattggaggtgacggatcattgacaggtgccaacacatttagaaat
gaatggtctggactggtaaaagaattattagatgcaaagattattaccacagaagatgcc
cagaaatgtaagttaattcaaattgttggaatcgtcggttcaattgataatgatttctgt
ggtaccgatatgacgattggaacagataccgcattacatcgaatcacagaagcagtcgat
tcagttcgatcaactgctcacagtcatcagcgatgtttcgttgttgaggtcatgggacgt
aactgcggctatctggcactagccgcatcactggcactggatgccgatttctgcttcatt
ccggaatggccaccacctcctcattggaagagtattttatgcaaaaagctgaaacaaatg
cgtgaggatggaaatcgtgtcaatattgtgattgttgccgaaggagccattgatcataac
ggcactgcgataacatcaagtatgattcgggatgtgatcaagaagaatatgaaatatgat
acacgtatcacaatcttgggacatatccaacgtggtggcagtccatctgccttcgaccgg
ttgctaggctgtagaatgggagcagaagctacaatagcattaatggaaatgaatgaggat
tcggaaccctgcgttgtttccattgatgggaatcagatggtacgcattccgttgatgaaa
tgcgtggaacgtacgaaagctgtcaaatcagcaatggatataaaggattgggcattggct
ctgaaattacgtggtcgtagttttcgacgaaacgtggaaatgtatcgtaccctatccaaa
atccgtaaacatgaaccggtattggaaggtttcaatattgctattatgaatgttggttca
ccttgcgcaggttgcaatgcagcagtgatgagctgtgtccgaacagctatccttcaagga
tgtgttccgtattgcatctataattccaatgaaggccttgcttctggtcagttccaaaaa
atggagtggaatgatgtggcgctgtggtctgcggaaggaggttcattccttggctcccaa
ccgggtcttcccactaatgacaccttaccattaatggctaagaatttgttaaacttcaat
atccatagtttgattataattggtggtttcaatgcttatcaaacatgtttgatatttgct
caaaatcgtgaaaattttccatcatttcggattccaatgtgtgtcattccgtccaccatc
aacaataatgtaccgggtacaggattcactcttggtgctgatacatcgttaaatgaaatt
tgcaaaatgattgataaaattaagcaatcagcaaccggttccaaacgtcgggttttcatc
attgaaacgatgggaagctattgtggttatttagccacattatcagcgatggcaagcggt
gctgatgcagcttatatctatgaagaaacatttgatgtccatgaactgatcaatgatata
cgtgttattgcggaaaagatgaaaaccggagctcaacgatatttgatagttcgcaatgaa
agagcatcagataactatacgtctgaattcatccggcaactgtttacggaagaaggtaaa
ggtattttcacaactcggaccaatatattaggtcacacacaacagggtggcaatccttca
ccatttgatcgactttttgctgcaaaaatgggtgctcgagcggttgttcatcttcttgga
cagatgaaagaatttaagaagacaaacctttgccatcccggtacagcaacactacaagga
ctaatcggcaaatatgtctgtttaacaccagtagaagaattgatggaagatgctgacttc
gcacatcgtctacccgtggaacaatggtggatgaagttacgacagctattacgcatactt
gcaaaacacgactag

KEGG   Loa loa (eye worm): LOAG_00771
Entry
LOAG_00771        CDS       T02664                                 

Name
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
loa00010  Glycolysis / Gluconeogenesis
loa00030  Pentose phosphate pathway
loa00051  Fructose and mannose metabolism
loa00052  Galactose metabolism
loa01100  Metabolic pathways
loa01200  Carbon metabolism
loa01230  Biosynthesis of amino acids
loa03018  RNA degradation
Module
loa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOAG_00771
   00030 Pentose phosphate pathway
    LOAG_00771
   00051 Fructose and mannose metabolism
    LOAG_00771
   00052 Galactose metabolism
    LOAG_00771
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00771
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:loa01009]
    LOAG_00771
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00771
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LOAG_00771
Protein phosphatases and associated proteins [BR:loa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LOAG_00771
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LOAG_00771
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 9938131
NCBI-ProteinID: XP_003136359
UniProt: A0A1I7V7Y8
AA seq 858 aa
MATQPEQKSATSIPTSQTAVLPSTQPTTVPPPEFVKPFELNAAIAPNTAANDDELGPLKE
ISARGKNFSKARSDSIIPTEGHEGIIIAPKLYKGQAVAVYTSGGDASGMNSAVRSVVRMG
LYLGCRVYFIYEGYQGMVDGGEYIKEAEWDSVSDIIQKGGTIIGSARCKDFRERPGRLRA
AENLIKKQITNLVCIGGDGSLTGANLFRQEWPSLVQELLISGKITQQESESCKNIQIVGL
VGSIDNDFCGTDMTIGTDTALQRIIEAIDSVVSTAHSHQRTFVIEVMGRHCGYLALVAAL
ASEADFCFIPEWPVPVDWPTVLCQKLHLMRHEGSRLNIIIVAEGALDRDGKPITANQVQN
VVKERLQYDTRVTVLGHVQRGGSPSAFDRLLGCRMGAEAVLALMEMTPTSEPCVVSIDGN
AIVRVPLMQCVHRTQAVQKAMETHDWDTAVKLRGRSFQRNLETYRLLTKLEPKSDVPSNE
PSYNVAVINVGAPAGGMNAVVRSFVRMGIYRRCKVYGVKNSFEGLANGDLKEMSWKDVNG
WVMYGGSFLGTQKQLPEKNMSQVAATLEKFKIHGLLMVGGFEAYHSCLMLSHARNQYPSL
RIPLCVIPCTISNNVPGTSISLGSDTAVNEICAVIDKIKQSATGTKKRVFIVETMGGYCG
YLATLSALASGADNAYIFEEKFDVSDIIEDVKVIARKMRTGVQRYLIVRCELANKNYTTQ
FVNQLFSEEGRGQFSTRINVLGHAQQGGNPAPFDRNMGTKLAANALEFILAQAKKYTDPV
SGVTNATTVDSATLLGLEDRRMVFTPVEELAQVTDFEHRLPKNQWWMRLRPLLRILAKHD
STYETEAFAVTDVENELD
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggcaacacaacctgaacaaaaatctgctacttcaatcccgacttcgcaaactgccgtt
ttgccttctacacaaccaacaacagtcccacctccggaattcgtgaagccatttgagcta
aatgcagctatcgctccgaacactgctgcaaatgacgatgagctgggtcctctgaaggaa
atatccgctcgtggaaaaaacttctcaaaagctcgatcagattccataataccaacagaa
ggtcatgagggtatcataattgccccaaagctctataagggacaagcagttgctgtgtac
acgagtggtggtgatgcttctggaatgaatagcgcagtacgatcagttgtccggatggga
ctttacctcggttgtcgagtatatttcatttatgaaggttaccaaggtatggtcgacggt
ggggaatatatcaaggaagctgagtgggattccgtatcagatattatccaaaaaggcggc
actataattggttcggctcgttgtaaagatttccgcgaacggccaggtcggcttcgtgct
gctgaaaatcttatcaagaaacaaattactaatttagtatgcattggaggtgatggctca
ttgacgggtgcaaatttattccgacaggaatggccaagtttagttcaagaattgctcata
tctggcaaaattactcagcaagaaagcgaatcatgcaaaaatatccagattgttggcctt
gtgggttccattgataatgatttctgtggcaccgatatgacgatcggtactgatactgcg
cttcaacgaattattgaggctatcgactctgtggtgtcaactgcgcacagtcatcaacgt
actttcgttattgaggtaatgggccgacattgcggttatttggcacttgtagctgcttta
gcatctgaagcagatttctgctttattcccgaatggccggtaccggtggattggcctaca
gtactgtgtcagaagctacatttaatgcgacatgaaggatcacgactgaatattatcata
gttgccgaaggagcactggatcgggatggcaagccgattacagccaatcaggtgcaaaat
gtagtaaaagaaagattgcaatatgatacacgtgtaaccgtgctgggtcatgtgcaacgt
ggtggtagtccatctgcttttgatcgacttcttggatgtcgaatgggtgctgaagctgtg
cttgcactgatggaaatgaccccaacatcggagccatgtgttgtgtccattgatggtaac
gccattgtccgagtaccgctcatgcagtgtgttcatcgcacccaagccgttcaaaaagcc
atggaaacgcacgattgggacacagccgtgaaattgagagggcgaagttttcagaggaat
ctagaaacttatcgcctgttgacaaaattagaacccaaaagcgatgtgccatcgaatgag
ccatcatataatgtcgccgtgataaatgttggagcacctgcaggaggaatgaatgcagtg
gtgcgttcattcgttcgtatgggcatttatcgtcgttgcaaagtgtatggtgttaaaaat
tcatttgaagggctagctaatggcgatctaaaagaaatgtcatggaaagatgtgaatggt
tgggtcatgtatggtgggtcattcttgggtactcagaaacaactaccagaaaagaatatg
agccaggttgcggcaacattggaaaaattcaaaattcatggattactgatggtcggaggt
tttgaggcttatcattcttgcttgatgctttcacacgctcgtaatcaatatccatcactt
cgtattccactttgcgtaataccttgcactatcagtaataacgtacccggtacatcgatt
tcattgggttccgatacagcagttaatgaaatttgtgcagtgattgataaaattaagcaa
tctgcaacgggcactaaaaaacgcgtatttattgtggaaacaatgggcggatattgtgga
tatctggcgactctttcagctctcgcatcaggagctgataatgcttatatatttgaagag
aaattcgatgttagtgatatcattgaagatgttaaggtcattgcccggaaaatgcgtact
ggtgtacagcgatacctcattgttcgttgtgaattggctaacaaaaattatactacacag
tttgttaatcaacttttttcggaagaaggcagaggacaattctcaacaagaatcaacgtg
ctaggacatgcacaacagggtggtaatccggcaccatttgaccgcaatatgggtacgaaa
cttgctgcaaacgctcttgaatttattttagctcaagcaaagaagtatactgatccggta
agtggagtgaccaatgcaactactgtggacagcgctacgcttcttggtctagaggatcga
agaatggtatttacaccagttgaagaattggctcaagtgaccgattttgagcatcgttta
ccgaaaaatcaatggtggatgagattacgaccgctattgagaatattggccaagcatgat
tccacatatgaaacagaagcgtttgctgtgacagatgtcgagaatgaacttgactaa

KEGG   Loa loa (eye worm): LOAG_06199
Entry
LOAG_06199        CDS       T02664                                 

Name
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
loa00010  Glycolysis / Gluconeogenesis
loa00030  Pentose phosphate pathway
loa00051  Fructose and mannose metabolism
loa00052  Galactose metabolism
loa01100  Metabolic pathways
loa01200  Carbon metabolism
loa01230  Biosynthesis of amino acids
loa03018  RNA degradation
Module
loa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOAG_06199
   00030 Pentose phosphate pathway
    LOAG_06199
   00051 Fructose and mannose metabolism
    LOAG_06199
   00052 Galactose metabolism
    LOAG_06199
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_06199
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:loa01009]
    LOAG_06199
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_06199
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LOAG_06199
Protein phosphatases and associated proteins [BR:loa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LOAG_06199
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LOAG_06199
SSDB
Motif
Pfam: PFK TGBp3
Other DBs
NCBI-GeneID: 9943608
NCBI-ProteinID: XP_003141783
UniProt: A0A1I7V7Y0
AA seq 815 aa
MEKSELLLGSPEDELGPLATGVHRMQLSMGSDSIVPSAGREGTSIAPQIYSGRAMAVFTS
GGDACGMNSAVRSVVRMGIYLGCRVFLIYEGYQGMVDGGDNIKEADWQSVSDIIQRGGTV
IGSARCKDFRERRGRLQAAENLIKRRITNLVCIGGDGSLTGANLFRQEWHDLIKELLSSG
RITQEEAKECDNIQIVGLVGSIDNDFCGTDMTIGTDTALQRICEAIDCVMSTAQSHQRTF
VIEVMGRHCGYLALVAALASEADFCFIPEWPVPTDWPTVLCQKLRMMRLAGSRLNIVIVA
EGAMDREGKSITAESVRSVVKETLHYDTRVTVLGHVQRGGNPSAFDRLLGCRMGAEAVLA
LMEMTPQSEPCVVSIDGNAIVRVPLMQCVQRTQAVKKAMDERDWETAVRLRGRSFQRNLA
TYRLLTKVQPKAVHPVVPVHIVAVINVGAPAGGMNAVVRSYVRMALYNGCMVYGIKNSFE
GLCRGEVQNMAWGDVNNWVMHGGSFLGTQKQLPEKIMDKVANAFKKYNFHALLLVGGFEA
YHSCLLLSRARDKYPSLRIPMCVIPCTISNNVPGTSLSLGSDTAVNEICEMIDKIKLSAT
GTKKRVFIVETMGGFCGYLATISALASGADNAYIFEEQFNVFDIMDDVKVISRKMRTGVQ
RYLIVRNEYANKNYTTEFVNQLFAEEGKGAFSTRTNVLGHAQQGGNPTPFDRNMGTKLAA
RALDFLLTQIGQYIDLKTGKLNAVSPDSATLLGLVGRRTVFTPVEQLALETDFEHRVPKH
QWWMKMRPLLRILSKHDSTYQTEAMVVPEVEDECT
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggagaaatccgaactgctgctaggttcacccgaagatgaacttggtccattggctact
ggtgtgcatcgaatgcaactttcgatggggtcagattctatcgtaccgtcagctggtcga
gaaggtacttcgatcgcaccacagatttatagtggtcgtgctatggctgttttcaccagt
ggtggtgatgcttgtgggatgaatagcgctgtacgttcagtagttagaatgggtatttat
cttggatgccgggtttttctcatttatgaaggatatcagggaatggtggatggtggtgat
aatatcaaggaagcagattggcagtcagtatcggatatcatacaacgtggaggtactgtt
attggatcagcacgttgcaaagatttccgagagcggcggggacgtttgcaagctgctgaa
aatcttatcaaacgtcgcatcaccaatcttgtgtgtattggaggtgatggttcattaacg
ggcgctaatcttttccgacaagaatggcatgatttgataaaagagcttctgtcaagtggg
agaataacacaggaagaggcgaaagaatgtgataacatccagatcgttggacttgttggt
tccattgacaatgatttttgcggtacagacatgactattggtactgatacagcactgcaa
cgaatctgcgaggcaattgattgcgtgatgtcaacggctcaaagtcatcaacgtacattc
gttattgaggtgatgggtcgtcactgtggttatttggcactcgttgctgcattggcttct
gaagcagatttctgtttcatacctgaatggccagtaccaacagattggcctacggtgtta
tgccagaaactgcgaatgatgcgtttagcagggtcacggttaaatattgtgatcgttgca
gaaggtgcaatggatagagaaggaaaatctattaccgctgaatcagtccgttcagtcgta
aaggaaactttacattacgatacacgtgtgaccgtgttgggacacgtacagcgtggtggt
aatccatcagcgtttgaccgattgcttggatgtcgtatgggtgcagaagcagtacttgct
ttgatggaaatgacaccacagtcggagccttgtgttgtttcaatcgatggtaatgcgatt
gtacgcgtcccactcatgcaatgtgttcaacgtacacaagcggtaaagaaagccatggac
gagcgtgattgggaaacagctgtgagattaagaggtcggagctttcaacggaatcttgcg
acttatcgcttgcttacaaaagtgcaaccaaaagcagttcatccagttgttccagttcac
atcgtagcagtaattaatgttggtgcgcctgctggtgggatgaatgcagtagtgcgttcg
tatgtccgtatggcactttataatggatgcatggtgtatggtataaagaattcgttcgaa
gggctttgccggggagaggtacagaacatggcttggggtgatgtcaataactgggtaatg
cacggcggctcatttcttggaacacaaaagcaactgcccgaaaagattatggataaagtt
gctaatgcgtttaaaaagtacaatttccatgcgctattacttgtgggtggatttgaggct
taccattcttgtttacttctttcacgtgcccgtgataaatacccatcgctgcgaataccg
atgtgcgttattccatgtactatcagtaataatgttccgggaacgtcgctttcccttggt
tccgatacagctgttaatgaaatttgcgaaatgattgacaaaatcaaactatcagctact
ggcactaagaaacgagtttttattgtcgaaacgatgggtggattttgtggttatttggca
accatttcggcattggcatctggagctgataatgcttatatcttcgaagaacaattcaac
gtatttgatattatggatgatgtaaaggttattagtcgtaaaatgcgtaccggcgtgcaa
cgttatttaattgtacgtaatgaatatgctaataaaaattacactacagaatttgtgaat
cagttattcgctgaagaaggaaagggagcattttcgacaagaaccaatgtattaggacat
gcacaacaaggtggtaatccaacaccattcgaccgtaatatgggaacaaaacttgcagcc
cgtgcattggacttccttttaacgcaaatagggcaatatatcgatttgaaaactggtaaa
ttaaatgcagtttctcctgacagtgccacactgttaggattggtgggtcgtcgtacagta
tttacacccgtggaacagttggcactagaaactgattttgaacatcgtgtaccgaaacat
cagtggtggatgaagatgagaccgctgctaagaatattatctaagcacgattctacatat
caaacggaagctatggtggtgccagaggtggaagatgaatgcacttga

DBGET integrated database retrieval system