KEGG   Loa loa (eye worm): LOAG_00357
Entry
LOAG_00357        CDS       T02664                                 

Name
(RefSeq) Rrp4-PA
  KO
K03679  exosome complex component RRP4
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00357
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00357
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_00357
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Core exosome
     LOAG_00357
SSDB
Motif
Pfam: ECR1_N KH_6 EXOSC1 Thymopoietin
Other DBs
NCBI-GeneID: 9937725
NCBI-ProteinID: XP_003135945
UniProt: A0A1I7VPI6
AA seq 295 aa
MSLEIAGPSSFKELEVVVTERRVPENKLIVPGAKVTSNPDFMRGHGTYMRGNDLIASVAG
TVEQVNKLVSVRPLKSRYNGEIGDVVIGRITEVQQKRWKVETNSRLNSTLLLSSVNLPGG
ELRRKSVEDERMMREYLKEGDLISAEVQKVHSDGQLLLHTRNLRYGKLSQGTLIKISPYL
VKRRKSHFHTLPCGVSVIFGRNGYIWIAPVVNEEQNMTGGYSQNLEEVVPMKIRSVIARV
ANCVNILAMHHIPLYDTTVVLAYDASLNSEINELLKPESAANIATEVALQLEKNC
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcactggagattgctggaccttcaagtttcaaggaactagaagtagtcgtaacggag
agacgagttcccgagaacaaattaattgtgcctggtgctaaagtcacttctaatcccgat
tttatgaggggacatgggacatatatgcgtggtaatgacttgatagcatcagtagccggt
actgttgaacaagttaacaagctcgtatcggtacgaccgttgaaaagcagatataatgga
gaaattggcgatgtggtgattggacgaattacagaagtacaacagaaaaggtggaaggtt
gagacgaattccaggctaaattcaacgttacttctttccagcgtgaacttaccgggtggt
gagctgaggagaaaatcggttgaagatgaacgaatgatgcgggaatacctcaaagagggc
gacctcattagtgctgaagtacaaaaggtgcactcggatggacaattattgttgcacacg
agaaatttaagatatgggaagctttcgcaagggactttgataaaaatttctccatatttg
gttaaacggagaaaatcgcacttccatacgttgccgtgtggtgtttctgtaattttcgga
cgtaatggttatatctggatagcacctgtagtaaatgaagaacagaatatgacaggaggt
tattcgcaaaatttggaagaggtagtaccaatgaaaatccgatcagttatagcgcgtgtg
gcaaattgtgtaaatattcttgccatgcatcatattccactctatgatacaacggtggtg
ctggcttatgatgcttctcttaattctgagataaatgaattgttgaagccggaatcagcc
gcaaacatagcaacagaagttgcattgcagctggaaaaaaactgctga

DBGET integrated database retrieval system