KEGG   Loa loa (eye worm): LOAG_00358
Entry
LOAG_00358        CDS       T02664                                 

Name
(RefSeq) EXOSome component family member
  KO
K11600  exosome complex component RRP41
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00358
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00358
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_00358
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     LOAG_00358
SSDB
Motif
Pfam: RNase_PH
Other DBs
NCBI-GeneID: 9937726
NCBI-ProteinID: XP_003135946
UniProt: A0A1I7VPQ4
AA seq 247 aa
MNIISEHGYRQDGRKPYQIRNLNYKLGVYSQADGSAYLEQGNTKVLCAVYGPYEPKQRSR
LLEDRCIINCQYSMATFSTNERKERPRGDRRSLEFARLMEKAFEAAVLTENYPRSQIDVF
CELLQADGSHLAACVNVGTLALADAGVPMRGLVAAASCACAPNGVACVDVNSREEMGIIP
RLTVATISGQDAVVLAELQNRLHKNYLIVILEAARRATAHVHSCLEAAVLTHIKAAIGLP
SDNDVEL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatatcatatcagagcatggttaccgtcaagatggtcgaaaaccatatcaaattcga
aacctaaattataaactgggagtctattcgcaggccgatggttcagcatatcttgaacaa
ggcaacactaaggttctttgcgcagtgtatggtccttacgaacctaaacaacgaagtcgt
ttgttggaggatcgttgcatcatcaattgtcagtatagcatggccacattctcaactaat
gagcggaaggaacgacctcgaggagatcgtcgatcgctggaatttgctcggttgatggag
aaagcgttcgaagcagcagttctgacggaaaactatccacgatctcagattgatgttttc
tgtgaactattgcaggcagatggaagtcatttggcagcatgtgtcaatgtgggaacatta
gcacttgctgatgcaggtgtgccaatgcgtggtttggttgcggcagcgtcatgtgcttgt
gcacctaatggagtagcgtgtgtagacgttaattcgcgcgaagaaatgggtatcattcct
cgactaacagtggctacaatatcggggcaagatgcagttgtgctggctgagttacaaaat
agattacataagaattatctaatagtgatattggaagcggcccgaagagcaacagctcat
gtacactcatgtcttgaagctgccgtattgactcatattaaggctgccattggtttaccc
tccgataatgatgtggaactttga

DBGET integrated database retrieval system