KEGG   Loa loa (eye worm): LOAG_00636
Entry
LOAG_00636        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12571  PAB-dependent poly(A)-specific ribonuclease subunit 2 [EC:3.1.13.4]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00636
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     LOAG_00636
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_00636
  mRNA degradation factors
   3'-5' decay
    Pan complex
     LOAG_00636
SSDB
Motif
Pfam: UCH_1 WD40_like UCH ANAPC4_WD40
Other DBs
NCBI-GeneID: 9938005
NCBI-ProteinID: XP_020304047
AA seq 1010 aa
MYGSSPGHSEDVLISADGLTPMSNEARIPEGGFALLSTTPQNAALAHFITALTFDSYQEL
LWTGNNMGRVVSFYGAQLDKYTAFLSASNSSIRSLLASETVIFSLTSKRLRANRRQGISL
FTHTSDHMTDLTCMHRLSDVPHKLLLGGNQQQIIQFDVETQKEIRIVSVKQKNCLALRSN
QKFLFSSDSEGNVTLRHLTTVDAIHALQAHQGSVADFDVCGNKLITCGYSPRLGKMAGDR
FIMIYDLRTLRSLPPVPLPIAPSYCRFLPSYSDGRIMVCSQSGELIIMDLNEQSGQMPIQ
LDTNGFAITSLDVSTSKQCIAFGDQTGLIHLFSDRMEPIFNENSWGTDFPDPIAFHPPVN
IDDPEPSYGVFPLPFPMDDHYASDWPEQLCIRRFRQPDPISEKVIDSMRMVQFVGYAHNP
RAGTPLRGFNVCPYTSSAHDKRFSNTMKSDELFHIPKFYLRSEGRLTSKADEIDSKRYNR
IEFNVLENSVETSPACMLLLAMYHLMNVRTVFLSHFCYLEGCISCEMNLLFRLLTDRPVS
SVLSAKNFMKTFRSIDDGKKWADAVANASLAQAVHLFMQAFSKVLDRELSETTAGVALRK
ELEISFTLNNHCIRCSEHYQSALSQLYMSLAYPTNNEKIGFCTLLEKTLNCPEQNEAICQ
KCGKLARFASTRRVRSLPNILALDMTASTETEQAFWISHIQAFESRAAITSNSITEQKVK
LCSQSETMTSMTEGTTSYSECPHYLPNSVHIKITDGICTVSENKMESSTSFHLAAGIFII
NENEEEGTNEHLVTAIRSKRDSCWILFNDWSVTRISEDEALRLHACWKLPAVLYYVQDKE
NVAKEAAKDENRAIIPRSVFWNDLDSNKIKIPERGSRVAIYAKYTINETGDKSVSEVSAV
DEDGNCFISSIIKEPGAKRDMDNSQTLKRVSEEQVKDIVLLYRSLFKRSLSLNALAQHFF
GESIEEDETDPIDLARLSLRLHTKFDELKEADETDINTTSLTQSVETNIS
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgtacggttcatcaccaggacatagtgaagatgtcttaatatctgcggacggtcttact
ccaatgagtaacgaagctcgtattccggaaggtggcttcgcattactgtcaacaacacca
cagaatgcagcacttgcacatttcattacagcacttacattcgactcataccaggaactt
ctttggaccggaaataacatgggacgtgtagtgtcgttttacggtgcacaacttgacaag
tacacagcattcttatcagcaagtaattcaagcattcgctctttgcttgcttcagaaact
gttattttctcactaacatcaaagcgcttaagagctaatcgtcgacaaggcatttcgtta
tttacacatacatccgatcatatgactgatcttacctgcatgcatcgactttcagatgta
ccgcataaattattgttaggcggtaatcagcaacaaatcatccagtttgatgtggaaaca
caaaaagaaatacgaattgtttctgttaaacagaaaaattgcttggcactacggtcgaat
cagaaatttttattcagttctgattcagagggaaacgtaacactccgacatcttacaaca
gtggatgcaatccatgccttacaagcacatcagggatcggtagctgattttgatgtttgt
ggcaataaacttatcacatgcggttactctccacgattgggtaaaatggcaggtgaccgg
ttcataatgatttatgatctaagaacgctgcgtagtttgcccccggtacctctaccaatt
gcgccgtcatattgcagatttctgccatcttattcggatggtcggattatggtttgctct
cagagtggtgaactaatcataatggatttgaatgagcaatctggtcagatgcctatacag
ttagatacaaatggctttgctattacatcccttgatgtatccacttcgaagcagtgtatt
gcttttggtgatcaaacgggtttaatacaccttttctcggatcgaatggagccaattttt
aatgaaaattcttggggcacagattttccagatccgattgcttttcatccaccagtgaac
atcgacgatcccgagccatcgtatggagtgtttcctcttccgtttccgatggatgatcat
tatgcttcagattggcctgaacaattgtgtattagacggtttaggcagccagacccgata
tcagaaaaggtgattgattcaatgcggatggtacagtttgttggatatgctcataatcct
cgtgctggtacaccattgcgcggctttaacgtttgtccatatacaagttccgctcatgat
aaacgcttttcaaatacaatgaagagtgatgaactattccacattccgaagttttatttg
cgttccgaaggaaggttaacctctaaggctgacgaaattgattctaagcgatataatcgc
attgaattcaatgtattagaaaatagtgtcgaaacaagtcctgcatgcatgcttctactt
gcaatgtatcatctgatgaatgtaagaactgtttttctttcgcatttctgctatctggag
ggctgcatttcatgtgaaatgaatctcctctttcggttacttacagaccgaccagtatcg
agtgtgttgtcggccaaaaattttatgaaaacttttcgatccattgatgacggtaaaaaa
tgggcagatgcagttgctaatgcaagtttggcgcaagcagttcacttatttatgcaagct
ttcagcaaagtactggatagggagctttctgaaactactgctggagtggcgcttcgcaag
gaactggagatttcgtttactttgaataatcactgtatccggtgttccgagcattatcag
tcagccttatcccagctttatatgtcactagcatatccaacaaataatgaaaaaattgga
ttttgtacattactcgaaaagaccctaaactgtcccgaacaaaatgaagctatctgccaa
aagtgtgggaagttagcacgattcgcatcaacacgtcgtgtgcgttcactcccgaacatt
ctcgctctagatatgacagccagtacagaaacggaacaagcattttggatttcccacatc
caggcatttgaaagtcgagcagcgataacgtcgaattcaataacagaacaaaaagtgaaa
ctttgtagtcaatctgaaacaatgacatcaatgacggaaggcactacctcatattctgaa
tgtcctcactatctgccgaactcagtacatatcaaaataacggatggtatttgcacggtt
tcggagaataaaatggaaagtagtacatcctttcacctagcagcaggcatatttatcatc
aacgaaaatgaagaagagggaaccaacgagcatttggtcactgcgatcaggtcaaaacgg
gattcttgctggatattgttcaacgattggtctgttacacgaatctcagaagatgaggct
ctgcgtctgcatgcttgttggaaattaccagctgtcctgtattatgtgcaagataaagaa
aatgttgctaaagaagctgccaaagatgaaaatcgcgctataattccacgatccgtattt
tggaacgatctggattcaaacaaaatcaagataccggaacgaggaagtagagttgcgatc
tatgcgaaatatacaatcaacgagactggcgataagtcagtatctgaagtttctgcagtc
gacgaagatggcaactgtttcataagcagtattataaaggaaccaggagcaaaacgtgac
atggataattcacaaacactgaagagagtgtcagaagagcaagtaaaagatattgtgctg
ctttatcgctcactgttcaaacgttcgctttcgttgaatgccttagcacagcatttcttc
ggcgaatcaatagaagaggatgaaactgatccgatcgatcttgctcgcctgtctctccga
ctgcacacaaaattcgatgagttaaaggaagccgacgagactgatatcaatactacttca
ttaacccagtcagtggagacaaatatttcttaa

DBGET integrated database retrieval system