KEGG   Loa loa (eye worm): LOAG_00677
Entry
LOAG_00677        CDS       T02664                                 

Name
(RefSeq) 3'-5' exonuclease
  KO
K12591  exosome complex exonuclease RRP6 [EC:3.1.13.-]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00677
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     LOAG_00677
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     LOAG_00677
SSDB
Motif
Pfam: DNA_pol_A_exo1 PMC2NT HRDC
Other DBs
NCBI-GeneID: 9938042
NCBI-ProteinID: XP_020304040
AA seq 844 aa
MSDEQSTSNPNDILDSVKNVKLCAVRAVGEANALPMRTEGYELYASFPLYTNLMMEQQRR
ITVMLRELLRNAGCRIPIPARINDLDEFLDRIVEANDNICERAGILLDLLQKARRMEEVV
VPQQILDAESTAASEQTLFEKQGRYTALLRRLPGYKDKLSSSAAVPLLTSKEKPQVVFGI
EVDNSFAEFKPKLREKHHAMENLVKNLQIVDNDNDIAISTMWRNDQGISLHPYYKELHHF
KIPTRQLTVGMVQSLKALSDTELVYVDTVEKLRNLRDILNKEQEFSVDLEHNAQRSFLGL
TCLMQISTRQTDYIIDPFPLWNDMHILNEPFTDPNILKVFHGADSDIVWLQRDFGIYVVN
MFDTYKAMRVLNYSKFSYQHLVQTCCNHTLDKKFQKADWRLRPLTGAHKTYARSDTHYLL
HCYDQLRIKLLDQGDAAGNLLEYVYNESAQTCLTVYKKPVFESDGYEKLLVGRKPLNSRQ
QFALAALWKWRDERARADDESPQYVLPCHMLLQIAEVLPREMQGILACCSPVPVHVKQEL
HVLHQIINTSRDQPLLKRPIYAPNIGSLTLEGVTSQLNKMNAVKAMLRCHLDFSSTKYNE
EIRDIVVQDVDRAICKDGAATGSCDSLFSTELYTIGEDNEKEDERLTKVMEKLEDWATPY
ECYRIAMMEQSSKAKIESKKKEDAARSEQSAAKEKKLWSHLDSAANKPGFVEEKVAANEL
QMESEQRKNAANEMNICEEMTLTKKELKKRRKRGVGQISIATTQKANEIQKSGGGVVEKR
GRKNNWTDAVENCDQRVDYSTFNPEIFNKNTVSISNTYDPFKQWKRGKSKPHRGRRMMQS
GRKL
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgagtgatgagcaatctaccagcaatccgaatgacatattggattcagtaaaaaatgtg
aaattatgtgcagttcgggctgttggagaggcaaatgctttacccatgcgtactgaaggt
tatgaattatatgcgagctttccgctgtataccaatcttatgatggaacagcaaagaagg
attaccgttatgttacgtgaactattgcggaatgccggttgtcgaattcccataccagcg
cgaattaatgatctagatgaattcttagatcgaatcgttgaggcaaacgataatatctgc
gaacgagcaggtattttgcttgatttactgcaaaaagctagacgtatggaggaagtagtt
gtaccacaacaaattctcgatgcagaaagtacagctgcatctgaacagacattgttcgag
aagcagggacgttatactgcacttttgcgacgtttacctggatataaggacaaactttcg
tcatcagctgctgttcctttgctgacgtccaaggagaagccacaggtcgtttttgggatt
gaggttgataacagctttgcggaattcaagccaaagctaagagaaaaacatcacgctatg
gaaaatctcgtaaagaatttgcaaatcgttgacaatgacaatgacattgctattagcacc
atgtggcgcaacgaccaaggaataagtttacatccttattacaaggaacttcatcatttt
aagattcctacaaggcagttaactgtcggaatggttcagtcgctgaaagcattgtctgat
actgaattggtatacgttgatacggtggagaaattaagaaatttgcgagatattttgaac
aaggaacaagaattcagtgtggatcttgagcataatgcgcagcgttcattcctaggacta
acttgtctcatgcaaatttcaacacgtcaaacagattatatcatcgatcctttcccgtta
tggaatgatatgcatatcctaaatgaaccgtttacagatccaaacatattaaaggttttt
cacggggcagattcggatattgtttggttacaacgggattttggcatttatgttgttaat
atgtttgacacatataaagcaatgagagtgcttaattattccaaattttcctaccagcat
ttggttcaaacttgttgtaaccatactttggataagaagttccagaaagctgattggcgt
ctaagaccactaaccggtgctcataaaacatacgcgagaagtgatactcattatttgtta
cattgttatgatcaacttcgtataaaactcctcgatcagggagatgctgctggcaatctg
cttgaatatgtttataatgaatctgctcaaacttgccttactgtttataaaaagccggtg
tttgaaagcgacggatatgaaaaattgttagtgggtaggaaacctttaaattctcgtcaa
cagtttgctttggcagctttatggaaatggcgtgatgagcgtgcaagagcagatgatgaa
agtccgcagtatgtcttgccgtgtcatatgctgctacaaattgctgaggtacttcctcgg
gagatgcaaggcattctggcgtgttgtagtcctgttccagtgcatgttaagcaggagttg
catgttttacatcaaatcattaatacatcacgtgatcagccgcttttgaagcgtcctatt
tatgcaccaaatattggttcactaactttagaaggtgtcacatctcaactgaacaaaatg
aatgcagttaaagcaatgttaaggtgtcatttggacttttcatcaaccaaatataatgaa
gaaattcgtgatattgttgtacaagatgttgacagagcgatatgtaaagatggtgcagca
acaggtagttgtgatagtttgttttccacagagctttatacaattggtgaagataatgaa
aaggaagatgaacgtctaacgaaagtcatggagaaattggaagactgggcgacaccttat
gaatgctaccggattgctatgatggagcaaagttcgaaagcaaaaattgagagcaagaaa
aaggaagatgcagcgagaagtgaacaaagtgccgcaaaggagaagaaattatggtcacat
ctcgattccgctgcaaataaacctggatttgttgaagaaaaagtggcagcaaatgaattg
caaatggaaagtgaacagaggaaaaatgccgcgaatgagatgaacatctgtgaggaaatg
acattaacaaaaaaagaattaaagaaaaggagaaaacgaggagtgggtcaaattagtatt
gcgacgacgcagaaggcgaatgaaatacaaaaaagcggtggaggagttgtagagaaacga
ggtcggaaaaataattggacagatgcagtggaaaattgcgatcaacgagttgactacagt
acttttaatcctgagattttcaataaaaacactgtgtcgatatccaacacatacgatcca
ttcaaacaatggaaacgtggaaaatcgaaacctcatcgtggccgccgaatgatgcagagc
gggcgcaaactgtga

DBGET integrated database retrieval system