KEGG   Loa loa (eye worm): LOAG_00912
Entry
LOAG_00912        CDS       T02664                                 

Name
(RefSeq) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
loa00010  Glycolysis / Gluconeogenesis
loa01100  Metabolic pathways
loa01200  Carbon metabolism
loa01230  Biosynthesis of amino acids
loa03018  RNA degradation
Module
loa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
loa_M00002  Glycolysis, core module involving three-carbon compounds
loa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOAG_00912
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_00912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_00912
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_00912
Enzymes [BR:loa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     LOAG_00912
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LOAG_00912
Exosome [BR:loa04147]
 Exosomal proteins
  Proteins found in most exosomes
   LOAG_00912
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 9938290
NCBI-ProteinID: XP_003136500
UniProt: A0A1I7VL38
AA seq 437 aa
MPITAIHARYIYDSRGNPTVEVDLATEKGMFRAAVPSGASTGVHEALELRDKDKGVHHGK
GVLKAVKNINEQIAPVLISKKMDPTQQKEIDQFLLQLDGTENKSKFGANALLGVSLAACK
AGAAHKCMPLYKYIAELAGMKEVVLPVPAMNVINGGSHAGNKLAMQEFMIMPVGASSFAE
AMRMGSEVYHHLKAEIKKRYGLDATAVGDEGGFAPNIQDNKEGLDLLKSAIAAAGYEGKV
VIAMDCAASEYYKDSAKKYDLDFKNPKSDQSKWKTGEEMLGLYKSFIKDYPIVSIEDWFE
QDDWNSWTKGLSSVDIQIVGDDLTVTNPKRIEMAVRNKACNCLLLKVNQIGTVTESIEAA
NLARKNGWGVMVSHRSGETEDTFIADLVVGLATGQIKAGAPCRSERLAKYNQILRIEEEL
GKSAVYAGTKFRNPQAA
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgccaatcactgccattcatgcccgttacatctacgattctcggggcaatccaactgta
gaagttgatcttgctacagagaaaggtatgtttcgagcagcggtgccaagtggtgcatca
acaggtgtgcatgaggcactcgaacttcgtgataaggataagggtgttcatcatggaaaa
ggagtcctaaaagcggtcaaaaatatcaatgagcaaatcgcgccagtactgatttctaaa
aaaatggatccgacccagcaaaaggaaatcgaccaattccttctccaacttgatggaacc
gagaacaaatcaaaatttggagctaatgcacttttgggtgtttcgctagcagcatgcaag
gctggtgctgctcataagtgtatgccgctatacaaatatattgctgaactagcaggtatg
aaggaagttgttctaccggtacctgcgatgaatgttatcaacggtggctcacatgccggc
aataaacttgctatgcaggaattcatgattatgcccgttggagcatcctccttcgctgaa
gcaatgcgcatgggctccgaagtttatcatcacctgaaggcagaaatcaaaaagcgatac
ggcttggatgctactgcagtgggtgacgaaggtgggttcgctccaaacattcaagacaac
aaggaaggtctcgatttgctgaaatcagcaattgctgctgcgggatatgaaggaaaagtt
gttatcgcgatggattgcgcagcttcagagtattacaaggactcggctaaaaagtacgac
ttggactttaaaaatccgaaatcggaccaaagcaaatggaaaactggtgaagaaatgtta
gggttgtacaaatcatttatcaaggattatccaattgtgtcaatcgaagactggttcgaa
caagatgactggaatagctggacgaaaggactgtcttctgttgacattcagattgttggt
gatgacctgactgtgaccaatcccaaacgaattgagatggctgtgaggaacaaagcttgc
aattgcttattgttgaaggtgaatcaaattggaactgtaaccgagtctattgaagcagca
aatttagcacgtaagaacggttggggcgtgatggtttcgcatcgatcaggtgaaactgag
gacacattcattgctgatctcgttgttggccttgccacgggacagataaaagctggagca
ccatgccgctctgaacgtctagcgaaatacaatcaaatactccgcattgaggaggagctt
ggcaaatcagccgtttatgcagggacaaaatttcgaaatccgcaagcagcatga

KEGG   Loa loa (eye worm): LOAG_14155
Entry
LOAG_14155        CDS       T02664                                 

Name
(RefSeq) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
loa00010  Glycolysis / Gluconeogenesis
loa01100  Metabolic pathways
loa01200  Carbon metabolism
loa01230  Biosynthesis of amino acids
loa03018  RNA degradation
Module
loa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
loa_M00002  Glycolysis, core module involving three-carbon compounds
loa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:loa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOAG_14155
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_14155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_14155
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_14155
Enzymes [BR:loa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     LOAG_14155
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LOAG_14155
Exosome [BR:loa04147]
 Exosomal proteins
  Proteins found in most exosomes
   LOAG_14155
SSDB
Motif
Pfam: Enolase_C MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 9951633
NCBI-ProteinID: XP_003149703
UniProt: A0A1S0TJ78
AA seq 250 aa
MHSKYLQAEIKKRYGLDATAVGDEGGFAPNIQDNREGLDLLNTAIATAGYTGKVAIAMDC
AASEYYKETDKLYDLDFKNPNSDKAQWKTGDQMMEIYQSFIKEYPVVSIEDWFDQDDWDN
WTKALANTHIQIVGDDLTVTNPKRIALAAEKKACNCLLLKVNQIGSVTESIDAANLARKN
GWGVMVSHRSGETEDTFIADLVVGLATGQIKTGAPCRSERLAKYNQILRIEEELGSAAIY
AGQKFRNPQA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcattccaaatatttgcaggccgaaatcaaaaaacgctatggtctcgacgcaacagca
gtgggtgatgaaggtggtttcgcccctaatattcaggataacagggaaggtcttgatttg
ttgaatactgcgattgcaacggctggatacacgggaaaagtagcgatcgccatggattgt
gctgcatccgaatattataaggaaacggataagctatacgatttagatttcaaaaatccc
aattcggacaaagcccagtggaaaactggtgatcaaatgatggaaatttatcaatctttc
attaaggaatatccagtcgtgtcaattgaagattggtttgatcaagatgattgggacaac
tggaccaaagcgttagccaatacccatattcagattgttggcgatgacttaactgttacg
aatccgaagagaattgcgttggctgctgagaagaaagcttgcaactgtcttttgctcaag
gtaaaccaaattggttccgtcaccgaatcaattgatgcggctaatttagctcgtaaaaat
ggatggggtgtgatggtatcgcatcgttcaggcgaaaccgaggatacatttatcgcagat
ctcgttgttggcctcgctactggacagattaaaactggagcaccatgtcgttcggagcgc
cttgccaaatacaatcagatacttcgtattgaggaagaacttgggtcagctgcaatttat
gccggtcagaaattccggaatcctcaagcatag

DBGET integrated database retrieval system