KEGG   Loa loa (eye worm): LOAG_01058
Entry
LOAG_01058        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K13126  polyadenylate-binding protein
Organism
loa  Loa loa (eye worm)
Pathway
loa03015  mRNA surveillance pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    LOAG_01058
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_01058
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_01058
   03041 Spliceosome [BR:loa03041]
    LOAG_01058
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     LOAG_01058
   mRNA cycle factors
    Stress granule specific factors
     LOAG_01058
Spliceosome [BR:loa03041]
 Complex C
  Other components
   Complex C specific factors
    LOAG_01058
SSDB
Motif
Pfam: RRM_1 PABP RRM_7 RRM_5 Nup35_RRM_2 RRM_occluded RRM_3
Other DBs
NCBI-GeneID: 9938429
NCBI-ProteinID: XP_020303926
AA seq 655 aa
MATVATAGAGMTPSYPMASLYVGDLHPDVTEAMLFEKFSSAGPVLSIRVCRDAITRRSLG
YAYVNFQQPADAERALDTMNFDMMYGKPIRIMWSQRDPSMRRSGAGNIFIKNLDKSIDNK
AIYDTFSMFGNILSCKVANDEESNSKGYGFVHFETEESAQKAIEKVNGMLLEGKKVYVGK
FQPRTARLREMGETARRFTNVYIKNFADELDKEALEKLFSKFGKITSAAVMVDADGKSKG
FGFVAFENPEDAEKAVTEMHEYELPGTERKLYVCRAQKKNERSAELKRRYEQQKVERMQR
YQGVNLYVKNLDDTVNDDILKQNFEAYGKITSAKVMCDDNGRSKGFGFVCFEKPDEATKA
VTEMNGKMMCTKPLYVALAQRKEDRKAQLASQYMQRLASIRMHNAGSMPGTVYTPGTGGF
FVSSTLQNQRAFMPTATIPGAQMRGTTPRWNTIGAAAGFGVQSPYMVQSGAYGQGGRGGT
RPTASSAAVAMRAQQGQYGPAQAGVTRGGPQAQRMAAGGAMVQNQGTRSQQMGGRQAQPG
KPSQGQMMYSSYSAITGRPGQVQSQQNSIVIQGQEPLTAHMLAQALPQEQKQMLGERIYP
LIERIYQGPDVGKITGMMLEMDNSELLMMLENEELLQSKVSEAASVLASSKGQNP
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcaacagtagcaacagctggtgctggtatgactccatcatatccaatggcttcactt
tatgttggagatttgcatccggatgtaactgaagcaatgctttttgaaaagttcagcagt
gccggtccagtactctccattcgtgtatgccgtgatgcaatcacgagacgctcgctgggt
tatgcttatgtcaactttcaacagccggccgatgcggagagggctttggatacgatgaac
tttgatatgatgtatggcaaacctattcgtatcatgtggtcacagcgtgatccatcaatg
cgtcgttcgggtgctggcaatatttttatcaaaaacctagacaaaagtatcgacaataag
gccatttacgatacattctcgatgtttgggaatatcctgagttgcaaggttgctaatgat
gaggagtcgaatagcaaaggatacggttttgtccatttcgaaactgaggaaagcgctcag
aaggcaattgaaaaagtgaatggaatgcttctggaaggaaaaaaagtgtatgtgggcaaa
ttccaaccacgtacggcacgtctgcgtgaaatgggcgaaacggctcgtcgttttaccaat
gtttacataaagaattttgctgatgaactagataaagaagcgctggaaaaactattttcc
aaatttggaaagataacaagcgcagctgttatggtagatgccgatggcaagtcaaagggt
tttggtttcgttgcattcgaaaatccggaagatgccgaaaaggctgtaacagagatgcac
gaatatgagcttccgggaacagaacgtaaactctatgtttgccgtgcacaaaagaagaat
gaacgctctgcggagctgaaacgccgctacgaacagcaaaaggttgaacgtatgcagcgt
tatcaaggagtcaatttgtatgtgaaaaatttggatgacacggtgaacgacgatatttta
aaacagaatttcgaagcctatggaaagatcacctcagccaaggttatgtgcgacgataat
gggcgttctaagggattcggttttgtttgctttgaaaaaccggatgaagcgacaaaggcg
gttactgaaatgaatggcaagatgatgtgtacgaagcctttgtacgttgctttggcacag
cgcaaggaagatcgtaaagcacaattagcatcacaatatatgcaacgtcttgcatctatt
cgtatgcataatgctggtagcatgcctgggaccgtttacacaccaggcactggtgggttt
ttcgtttcatcgacgttgcagaatcaacgagcttttatgccaactgcaactattcctggt
gctcaaatgcgcggaacaacaccaagatggaatacgattggcgcagcggctggatttggt
gtacaatcgccatatatggtccagagtggtgcatatgggcagggtggcagaggcggtact
cgtccaacagcttcctctgctgcagtggctatgcgagctcagcagggtcagtatggacca
gcgcaggctggtgttacgcgtggaggtccgcaggcgcaacgtatggctgcaggtggtgct
atggttcaaaatcaaggtacacgctcgcaacagatgggaggacgacaagcacaaccggga
aaacctagccaaggacaaatgatgtattcatcgtacagtgccattactggacgtccaggt
caggtacaatcgcagcagaacagcattgtcattcagggtcaagaaccgttgaccgctcac
atgcttgcacaggctcttccacaggagcaaaagcaaatgcttggtgagcgtatttatccg
ctcattgagcgcatctatcagggtcctgatgttggtaaaataaccggaatgatgcttgaa
atggacaactcagagttgctgatgatgctcgagaacgaggaactgttacaatcgaaagtt
tcagaggcagcatcggtgttggcatcttcgaagggtcaaaatccttga

DBGET integrated database retrieval system