KEGG   Loa loa (eye worm): LOAG_01360
Entry
LOAG_01360        CDS       T02664                                 

Name
(RefSeq) exodeoxyribonuclease III
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_01360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_01360
Enzymes [BR:loa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LOAG_01360
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     LOAG_01360
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-GeneID: 9938733
NCBI-ProteinID: XP_003136947
AA seq 313 aa
MLGKHGRMKKRRRDDKEEAFKNASNDKEDVTDEHIKMGSEKRVMERKKKKVGKSGREIKI
ISWNVAGLRAWIKKDGHSILVKENPDIVALQETKCVEVPNELQNGYYSFLNTSEKSGHGG
VLLLTKEEPIKVTYTFDDKSKSGLDGNGKGRIIIAEYENYYLINAYVPNSGRGLVNLDKR
KFWDDCYFSFIKKLDLNKPIVYVGDLNVAHQEIDLANPKTNYNKTAGFTDQERNDFTRLL
DAGFVDVFRRLNPEKEGVYTFWSNMRNAREKNVGWRLDYFVVSERIMNKVKECDILCSVK
GSDHCPLSLTIEL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgcttggaaagcacggaagaatgaagaagagaaggagagatgataaggaggaagcattc
aagaatgctagcaatgataaggaagatgtgaccgatgagcacataaaaatggggagtgag
aaacgtgtaatggagagaaagaagaagaaagttggaaaaagtggcagagaaatcaaaatt
atcagctggaatgttgctggtctcagggcatggattaagaaggatggccactcaattttg
gttaaagagaatccggatattgttgctctacaagaaacaaaatgtgtggaagttccaaat
gaattgcaaaatggttactacagtttcttgaatacttctgaaaagtctggacacggcggt
gtattattacttacaaaagaggagccgataaaggtaacatatacttttgatgacaaatct
aagtctggtctggatgggaatggtaaaggacggattattattgctgaatatgagaattat
taccttattaacgcttatgttccgaatagtggacgtggtctagtgaaccttgacaaacga
aagttttgggatgactgctacttcagttttattaaaaaacttgatttaaataaacctatt
gtgtatgttggagacctaaacgttgcgcatcaggaaattgacttggcgaatccgaaaacc
aattataacaagacagctggattcacggatcaggaacggaatgattttactcggttgctt
gacgccgggtttgtggatgtttttcgcagattaaatccagaaaaagaaggtgtttataca
ttttggtcgaacatgcgcaacgctagagaaaagaatgtcggttggaggctcgattatttt
gtggttagtgaacgaattatgaataaagtaaaggagtgtgatattctctgttcagtcaag
ggaagcgaccactgtcccctgagtcttacaattgaattgtga

KEGG   Loa loa (eye worm): LOAG_10727
Entry
LOAG_10727        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_10727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_10727
Enzymes [BR:loa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LOAG_10727
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     LOAG_10727
SSDB
Motif
Pfam: AP_endonuc_2 HpaB_N
Other DBs
NCBI-GeneID: 9948172
NCBI-ProteinID: XP_003146299
UniProt: A0A1I7VC81
AA seq 479 aa
MEQSVATDMKSAMISVDAKEGSSSTRRVHPKLVLPNSSSNDNEMGRSSCAEIPQDKHKGE
VKQEYISDKWENVEAVLVGKNSKKEMVKSKFTRIKSRTTKNLNINKMKKSCDSRSSAGTR
TRKWTGIRESTNKTKQDSKEASVNMDYSTVPKRKCSANVILKENSSAIDLTAQKVVEAAV
GSRKMLGVHVSVAGGLEQGFYNALSIGCRSFAFFVRNQRSWNSPPMKDEVVQAFRKTAQK
LKFPMDQIVVHGSYLINGGSCDMEILDRARACMLDECKRCEQLGIIYYNIHPGSTAGKCT
RDECIKTIAATLDYVMDHTEYITILIETMAGQGNTIGGKFEELQQIINLVKNKKRVGVCL
DTCHIFAAGYDIRSEDRYKATITEFENTIGLQYLRAFHINDSSGDLGSRLDRHANIGKGK
LKLAAFRHIIADPRFDGLPMILETPEGDYAGEMIRLYQSLNSKPLKEHKKDIRSFFSPI
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggaacaaagtgtcgcaacggacatgaaatcagcgatgatcagtgtggatgctaaggaa
ggatcgagcagtacaaggagagtgcatccaaaattagtattaccgaattcttcttcaaat
gataacgaaatggggcgaagttcttgtgctgaaattccgcaagataaacataaaggagaa
gttaagcaagagtacatatcggacaaatgggagaatgttgaagcagttttagtgggaaag
aattcaaagaaagagatggtgaagtcgaaatttactcggatcaagtcaagaacgacgaaa
aatttgaatataaacaaaatgaaaaaatcatgtgatagcaggagcagtgctggaacgaga
actaggaaatggacaggaatacgagagtccactaataaaacaaagcaggactcgaaggag
gcatctgtcaacatggactactcgacagtaccaaaacgaaaatgttcagcgaatgtaatc
ttaaaggagaatagttcagctatagatctcaccgcgcaaaaagtggtggaagcagctgtc
ggatcaaggaaaatgcttggagtacatgttagtgtagcaggtggtttagaacaaggtttt
tacaacgccttatctattggatgccgatcttttgctttttttgtccgaaatcaacgttca
tggaatagtccacccatgaaggatgaagtggtgcaagcgtttcgtaaaaccgcacagaaa
ttgaaattcccaatggatcaaattgttgtgcacgggtcatatctgataaatggtggtagt
tgtgatatggaaatactggaccgagctcgagcgtgcatgttagatgaatgtaaacgatgc
gaacagcttggtatcatctattacaatattcatcctggatctacggcagggaaatgtaca
cgtgatgaatgcatcaaaacaatcgcagctaccttggattatgttatggatcacactgaa
tatattacaattttgattgaaacaatggctggacaaggaaatactattggtgggaagttt
gaagagctacaacaaattattaacttggtgaaaaataagaaacgagtgggagtgtgcctt
gatacttgtcatatttttgctgcgggttatgatatacgatcagaagaccgatataaagca
actattaccgaattcgagaatactattggtctccagtatctccgtgcttttcatatcaat
gactcatcgggtgatcttggctctagattggaccgtcacgcaaatattggtaaaggcaag
ctgaagctggcagcttttcgtcatattatagctgatccacgattcgatggtttaccaatg
atcctagaaacaccggaaggagactatgcaggagaaatgattcgattatatcagtcattg
aatagcaaaccactgaaagaacataagaaagatatccgatcattcttttcacccatataa

DBGET integrated database retrieval system