KEGG   Loa loa (eye worm): LOAG_01377
Entry
LOAG_01377        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12602  WD repeat-containing protein 61
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_01377
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_01377
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     LOAG_01377
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 9938751
NCBI-ProteinID: XP_020303848
AA seq 409 aa
MKSGSGSVSVERVQSSMTVLSEEASNREERFVTLKKIAKVHGRAIIGVSYIQDPYSQEDY
LITCAHDSLKVWHVDKNDPGTLTEKQEIKGWRSGAQDFDATSDGAMIAVVGIDSLMYVFN
LSLSDFTYNADIFNMGFMEQWYVRISPCRTHYLTVSFSGFLSRLSLKGTTDDNLSFPGAR
QVSSLSYSPDNKMIAVANNEGIVTILNVPKLEIRFFFEAHAIRVRATCFSPSSDNLLTGS
DDKIVKLYVIRTEKAQLVKSFCGHKSCITAISYNPRDPQMFASSSNDGSVILWSTTEDCA
LHIFQGAHEGVVKGLSFSVDGVCIASVGEDRAVCIHRLGNRKSVVELAESNWSTNQKLDS
QQIDYSATIANKNSILITSENRKNGEEEDELLMRAKRDLEGISDEASPE
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaagagcggttcgggcagtgtgagcgttgaacgtgtgcaatcgtcgatgacggtccta
agtgaggaagcgtcgaacagagaggaacgcttcgtgacccttaagaagatcgcgaaagtt
catggacgtgcaatcatcggtgtatcttacatacaagatccttattcacaggaagattac
ttaataacatgcgcccatgattctctcaaagtatggcacgtggataaaaatgatccagga
acattaacggagaaacaagaaatcaaaggatggaggagcggcgcgcaggatttcgatgct
acatccgatggggcaatgatagcagttgttggtatcgattctttgatgtatgtgtttaat
ttatctttgtctgacttcacatataacgctgatattttcaacatgggattcatggagcag
tggtacgttagaatatcaccctgccgaactcattatcttacagtaagtttttctggattt
ttgtcgcggttgtctttgaaaggtactactgatgataatctcagttttcccggagcacga
caggtctcttcgttatcatatagtccagacaacaaaatgattgccgtagctaacaatgaa
gggattgtcacaattctcaatgtaccaaaacttgaaattcgatttttctttgaagcacat
gcaatcagagtgagagcaacatgtttttccccgtcatcggataacttgttgactggctcg
gatgacaagattgtcaaactttatgtaatccgcacagagaaagcacaattggttaaaagt
ttttgtggtcataaaagttgtattacagcaataagttataatcctcgagatccacaaatg
tttgcaagttcatcgaacgatggctctgtaattctatggagtactacagaagactgtgca
cttcacatttttcaaggagctcatgagggagtggtgaaaggtctttcgttttcggtagac
ggagtgtgtatagcaagcgttggtgaagatcgtgcagtttgtatacaccgtttgggtaat
cggaaatctgtagtagaactcgctgaaagcaactggtcaaccaatcagaaacttgatagc
caacaaatagattacagtgcaacgattgcaaacaagaattccatactgataacttccgaa
aacaggaaaaatggtgaggaagaagatgagctcctaatgagagcgaagagagatctggaa
gggataagtgatgaagcatcgcctgagtga

DBGET integrated database retrieval system