KEGG   Loa loa (eye worm): LOAG_01467
Entry
LOAG_01467        CDS       T02664                                 

Name
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_01467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_01467
Enzymes [BR:loa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     LOAG_01467
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LOAG_01467
 Prokaryotic type
     LOAG_01467
SSDB
Motif
Pfam: UDG DUF4106
Other DBs
NCBI-GeneID: 9938843
NCBI-ProteinID: XP_003137054
UniProt: A0A1S0UAX6
AA seq 292 aa
MNKASSIAKAASSEVSAKCGNLMSWLKRKEVPLEKETAAKISLVEEKDASESGKEDVISV
RQGSVEYLKNLVEDIGWRRVLLVEFRKEYMDKIVKFLQMEKEKGVKIFPPQHQIFNAFNL
TPLKQIRVVLIGQDPYHGENQAHGLCFSVCKGVRLPPSLINIYKELKMDIPNFKVPDHGC
LESWAHQGVFMLNATLTVEAHRPNSHNHIGWQKFTDEVIRIISRECKGIVFLLWGGFAHK
KEYIIDKKKHIVIKTAHPSPLSARMFFGCKCFSRTNEALVKLGQPAIDWSTF
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaataaagcatcttccatcgccaaagcagcatcgtcggaagtatcagcaaaatgcggt
aatcttatgtcgtggctgaaacggaaggaagttcccttggaaaaggaaactgcagcaaag
atttcacttgttgaggagaaagatgcttcagaatcagggaaagaagatgttatatctgtg
cgacaaggatcagtagagtatctaaaaaatctggttgaagatattggttggcgaagagtg
cttttggttgagtttcggaaggaatatatggataaaattgttaaatttttgcaaatggaa
aaagaaaagggagtgaagatttttccaccgcagcatcaaattttcaatgcctttaacctt
actccactcaaacaaattcgcgttgttctcataggtcaagatccctatcacggcgagaac
caggcacatggactatgcttctcagtttgcaaaggtgtcagactcccaccctcacttata
aatatctacaaagaactgaagatggatataccgaacttcaaagttcccgaccatggctgt
ctcgagtcttgggcgcaccagggtgtctttatgttgaacgctactctgactgttgaagct
catcgaccaaattcgcataatcatatcggatggcagaaattcactgatgaagttattcgc
atcatttcacgtgaatgtaaaggaatcgtctttttgctttgggggggattcgctcataag
aaggaatatataattgacaagaaaaagcacattgttatcaagactgcacatccgtctcca
ctaagtgcgcgtatgtttttcggttgcaaatgtttttcgagaacgaatgaagcgctggtg
aaacttggacaaccagctattgattggagcacattctga

DBGET integrated database retrieval system