KEGG   Loa loa (eye worm): LOAG_01591
Entry
LOAG_01591        CDS       T02664                                 

Name
(RefSeq) excitatory GABA receptor EXP-1A
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_01591
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:loa04040]
    LOAG_01591
Ion channels [BR:loa04040]
 Ligand-gated channels
  GABA-A
   LOAG_01591
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb PepSY_TM_like_2 Jas_motif
Other DBs
NCBI-GeneID: 9938967
NCBI-ProteinID: XP_003137178
UniProt: A0A1S0U8N7
AA seq 506 aa
MIAVIHFWISLLVNGTSQTAANFHASDVKKSGGYDFMADDDSVVQWSTYYRNNNGNRTSD
FFHFLVRTDYDHRKEPENDNGEAVAINVSIVVSNIRAVSEVTMDYALELFYRESWLDKRL
RYQNHFKDRKISLHESYINFLWHPDTFMPNAVASKNPQKHSISHRSLLRLNEDGAILYSR
RISIVAECPMDLTLFPFDSQLCKLGIESYGYTADRVRYFWSRDVKAPLLLQKIRLPDFQI
KEAYVTSVIENYATGNYSRLYVCFVFDRSSGFCLIQLVVPSTAVVVTSWVSSWMENETEF
QDMVSIILAITFLIFSYNEMMPRVSYIKAMDIYLGVCFMAVFLSLIKIAFVKFMRQRLNK
NRKQSSVVASMLAKVNMATNDTFNEPGIIIASSRTTCVDFDLPSLRRRSCRLSNSHTSIS
MNDPYELDHYLEKRREFRCFTLKHLLDNCRLTKKSVQMFHWISQVIFLITFTSFCLFYFL
LYPNMHSKMEDAECDRTKSEWFAEIT
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgatagcagtaattcatttttggatatcgctgttggtgaatggaacaagtcagacagct
gcaaactttcatgcatctgatgtcaaaaagtcaggtggatacgacttcatggccgatgat
gattccgttgtgcaatggtccacatactatcggaacaataacgggaatagaacgagcgat
ttctttcatttcctagttcgcactgattatgatcatcggaaagaaccggaaaatgataac
ggagaagcggttgcaatcaatgtatcaattgttgtcagtaatattcgcgccgtttctgaa
gttactatggactacgctcttgaattattttatcgcgaatcatggctggacaaacgattg
cgttatcagaatcatttcaaagatcggaagatatcactacatgaaagttacatcaacttc
ttgtggcatccggacacattcatgccaaatgctgtcgcttcaaaaaatccgcaaaaacac
tcaatttcacaccgttctttgctgaggttaaatgaagatggcgcaattctatatagcagg
cgtatttccattgtggccgaatgtccaatggatcttacactctttccatttgattcacaa
ttatgtaaacttggcatcgaaagttatggatatacagcagaccgtgtgcggtatttttgg
tccagagatgttaaagcaccgctgctgctgcagaaaatccggttaccggacttccagatc
aaagaagcttatgtaacgagtgttattgaaaattatgctacaggcaattatagcagactt
tatgtatgttttgtatttgatcgttcatcgggattttgtctgatacaattagtagttcca
tccacagcagtcgttgtcacttcctgggtctcatcatggatggaaaacgagactgaattt
caggatatggtttcaattatactggcaataacgtttttgatattctcatacaatgagatg
atgcctcgtgtaagctacattaaagctatggatatttaccttggtgtatgctttatggct
gtgtttttatcattaatcaaaattgcttttgtaaaatttatgcgacagaggctgaataaa
aacagaaagcaatcctccgtggttgcatcgatgttagcaaaggttaatatggccacaaat
gacacatttaatgagcctggaattattatcgcatcatcgcggacgacttgtgttgatttt
gatttgccgtctttacgaagacgatcatgtcgtttgtctaattcgcacacatcaatctca
atgaatgatccatacgaattagaccattatttggaaaaacgacgagagtttcgatgtttc
actttaaagcatttgttggataattgtcgattaacaaaaaagtcagtacaaatgtttcac
tggatatctcaggtgatttttttgataacattcacgtcattttgtctattctacttcctg
ttatatcccaacatgcactctaaaatggaagacgctgaatgcgatcgtacaaaatcggaa
tggttcgccgaaattacttaa

KEGG   Loa loa (eye worm): LOAG_05053
Entry
LOAG_05053        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_05053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:loa04040]
    LOAG_05053
Ion channels [BR:loa04040]
 Ligand-gated channels
  GABA-A
   LOAG_05053
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 9942461
NCBI-ProteinID: XP_020302943
AA seq 355 aa
MISLITFILFYTTIFQCYNSKGIIQEDILSYNTSLIHNITQVLDTILLKQDRHFRPINGD
SNVPLQVEIDISVRSIGPISEQKMEFSMDCYFRQKWLDRRLAFDTFGNRNDLPISSKMLN
DIWTPDTYIRNGRHSYLHTLTVPNVLFRVRHDGQIHVSQRLTIRSRCKMFFKKFPMDCQA
CPIEIGSLGYFSKDIVYVWKDVELDSKMSNMLAQYQLLHVIKTSHNWTDPHDNKLNISVL
KVYFKLQRQQGFYILQIYTPCTLIVVVSWVSFWINKESSPARVSLGIMTVLSVSTLGFSY
RSDLPKVSHSTALDIYIISCFGFVFAAVIEYAIINYVNRTNIRKKYRKYAYHQSH
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgatttcattgatcacatttatcctcttctatactacaatatttcaatgttacaattct
aaaggaataatacaagaggatatcttatcgtataatacatcactaatacataatatcacg
caagttctagatactatcctcctcaaacaggatcgtcattttagacctatcaacggagat
tcaaatgttccattgcaagttgaaattgatatatctgtacgtagtattggaccaatatcg
gaacaaaaaatggaattttcgatggattgttattttcggcaaaaatggttagatcgacga
ttagcctttgatacatttggtaatcggaatgatttgccaatatcaagcaaaatgctgaat
gatatatggacacctgatacatatattcgaaatggacgacattcatatttgcatactcta
acagtacccaatgtcctctttcgagttcgtcatgatggacaaattcatgtttcacaaaga
ttaacaatccgaagtcgatgtaaaatgtttttcaagaaatttccaatggattgtcaggca
tgtccaattgaaattggtagtttgggttatttttccaaagatatcgtttatgtttggaag
gatgtggaattagactcaaaaatgagcaatatgcttgcacaatatcagctacttcatgtc
atcaaaacgtcacataattggactgatcctcatgacaacaaattaaatatatcggtgctt
aaagtatattttaagcttcaacgtcaacaaggtttctatatactacaaatttacactcct
tgtacattgatcgttgtcgtatcatgggttagtttctggatcaataaagaatcatcacca
gctcgagtctcattaggcataatgacagtactttccgtgtcaacattgggcttcagttat
cgatctgatttgccaaaagtttcgcattcaacagccctcgatatttatattatttcgtgt
ttcggatttgtatttgctgcggtgatcgaatatgctattatcaattatgtaaatagaact
aatatccgaaaaaagtatcgaaaatacgcatatcatcaaagccactaa

KEGG   Loa loa (eye worm): LOAG_05504
Entry
LOAG_05504        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_05504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:loa04040]
    LOAG_05504
Ion channels [BR:loa04040]
 Ligand-gated channels
  GABA-A
   LOAG_05504
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 9942913
NCBI-ProteinID: XP_020302831
AA seq 556 aa
MNCSYTLIFLLRTTALLIIQIFQATATTELTGCEKCDLRSSFCQKSSSTGKVNCICRSGF
VADSIGKCRHMLDSREINMSNNKCISGQDEGIAEKILSEILKTYDRNLVPSAKGVDVDVE
ILIQQISEISEIQSSSKMHILLAQIWRDPNLSFQDIEGADCVQNLTLSHRMVEKLWLPNV
CIVNSKGSLIHHSPTPNVFLSILPNGTVWINYRIMVETPCEMDFSIFPMDRVECIMVFES
YSFNVGKVRLHWKRHGIPVEVIGQTNLPDFHMTHYIHEKASFHYPAGVWDHLNIKLYFRR
SYGFYLLQIYLPTYCMVLISWISFWLDRRSLPARVTVGVSSMMALTLQYSNVARTLPKVS
YVKGLDLFMFGCVGYIFLSIVELAIVGMLEKPTTSRSRGNAENDTDCNLLLNECRPSKRL
FRENRRRKLSLIERVDEDAQISGKVDVDLNDSLWTRNTATFTNYNEQRTTSTIRYPEIMK
LNNYNDDNMIRYSPCTISEGSRSYSKCRRKKQSNERRFLRHWTGEDMDNLCQKVFPISFT
LLNMIYWMYYTARAND
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgaattgttcgtatacattgatttttttactgagaactactgctctactcatcattcaa
atctttcaagcaactgcgactaccgagcttacaggttgtgagaagtgtgatttacgttca
tcgttttgtcaaaaaagtagcagtacgggtaaagttaattgtatatgtcgttctggcttt
gttgctgatagtatcggaaaatgtcgccatatgcttgattctcgtgaaattaatatgtca
aataataaatgtatttcgggacaagatgaaggaatagctgaaaaaatattatcagaaata
ttgaaaacatatgatcgaaatttggtgccatcagcaaaaggtgttgatgtggatgttgaa
atacttattcaacagatatctgaaatttccgaaatacaaagtagttctaagatgcatatt
ttgttggcgcaaatttggcgagatcccaacttatcatttcaggatatcgaaggagctgat
tgtgtgcaaaatttaactttatcacatcgaatggtcgagaaactatggttaccaaatgtg
tgtattgttaacagtaaaggatcattgatacatcattcacctacacccaatgttttcctt
tctattcttccaaatggaaccgtttggataaattacaggattatggtagaaacaccatgt
gaaatggatttttcaatttttccaatggatcgtgttgaatgcataatggtttttgaaagt
tattcatttaatgttggtaaagttcgtttacactggaaacgtcatggaattccggtggaa
gtaatcggacaaacaaatttaccggattttcatatgacacattatattcatgaaaaagca
tcattccactatccagcgggtgtttgggatcatttaaatataaagttatactttcgtcgc
tcttacggtttttacttgttgcaaatttatctaccaacctattgtatggtactcatctca
tggatatcattttggttggatcgtcgatcgcttccagctcgtgtcaccgttggcgtttcg
tcaatgatggcacttactttgcaatattccaatgttgcaaggacacttccaaaagtttca
tatgtaaaaggtttggatttatttatgttcggttgtgttggctacatatttctatcgatt
gttgaattagctattgttggaatgttagagaaaccaactacatcaaggagtcgcgggaat
gctgaaaatgatactgattgtaacctactcctgaatgaatgccgaccaagtaaacgatta
ttcagggaaaatcgtcggagaaagttatcgttaattgaacgggttgatgaagatgcacag
atatccggaaaagtcgacgttgatttgaatgatagtttatggacacgtaatacggcaaca
ttcactaattacaatgaacaaaggacaacatcaacaattcgatatccggaaataatgaaa
ttaaataattataatgatgataatatgatccgttactcaccttgtacaatttccgaagga
tcaagaagttacagtaaatgtcgtcgtaaaaaacaaagcaatgagaggagatttttacga
cattggactggagaagatatggataacttatgtcaaaaggtttttccgatttcattcaca
ttactgaatatgatatattggatgtattataccgcaagagcgaatgattaa

KEGG   Loa loa (eye worm): LOAG_10339
Entry
LOAG_10339        CDS       T02664                                 

Name
(RefSeq) ACC-1 protein
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_10339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:loa04040]
    LOAG_10339
Ion channels [BR:loa04040]
 Ligand-gated channels
  GABA-A
   LOAG_10339
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 9947781
NCBI-ProteinID: XP_020301687
AA seq 420 aa
MASLSLAFCFDAPQRLEKRVELEAAAMSQKTILGWSSRTCCLQKVLLLQLCAVAVVTFRP
ERCSNDTDVMDHLLTEAALRHNRHKLPSRPVIVRIEMWIQEVTYVSELTQDFEIDLYVNE
FWEDPALNYEVLLPCNGNLSFDHSIHESIWIPNTCFINSKKALIHSSPFRNVFLMVFPNG
SIWSCWRIKSTGPCLMDLRNFPMDSISCMLTFESYNYNIQEVRMKWNEPHAVLMFKDIEL
PDFTLVNYTISVIEAEYAAGLWDELTVSFTFKRRYGWYILQGYIPTYLTIFISWIPFYMS
PRAMPARTMIGVNSLLAMTFQFGNIIRNLPRVSYIKAIDIWVLSGMTFIFASLIELAMVG
FMSRHEGQADTKLNHMQKERKSSILDSEKLDLYSRTSFPLVYATFNMIYWGYYMNGLLLQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcttctctttccttggctttctgctttgacgcccctcaaaggctagaaaagagggtt
gagcttgaggcagcagccatgtcccaaaaaacgatcttaggttggtctagtcggacttgt
tgcctgcaaaaagtgctattactgcaattatgtgcagttgcggtagtaaccttccgtcca
gaacgctgctctaatgacaccgacgtcatggatcatcttttaactgaggctgcactccgc
cacaatcgccataagttaccgtctagaccagttattgtacgaatcgagatgtggattcaa
gaagtaacttatgtttccgagttaactcaggattttgaaattgatttatatgtgaacgaa
ttttgggaggatccagcactcaactacgaagtgcttctcccatgtaatggcaatttaagc
tttgatcacagcatccatgaaagtatttggattcctaacacctgttttattaattcgaaa
aaagcacttatccacagctcgccattccgcaatgtttttcttatggtctttccaaatggc
tcgatatggtcgtgctggcgtatcaagagcacgggtccatgtcttatggatctgcgtaat
tttccaatggattctatatcatgtatgctaacatttgaatcttataattacaacattcag
gaagtgcgaatgaagtggaacgaacctcatgctgtattaatgtttaaggatatcgaatta
ccagatttcactttggtcaactacacaatctctgtcatcgaagctgaatatgcagcgggc
ttgtgggacgaacttactgtttctttcacgttcaaaaggaggtatggatggtacatttta
caaggatatatcccaacgtatttaacgatatttatctcatggataccattttatatgagt
ccgcgagcaatgccagctcgaactatgattggtgtcaattctctccttgcaatgacattc
caatttggaaatattatacggaatctaccacgagtatcttatattaaggcaattgacata
tgggtcctgagtgggatgactttcatattcgcgtcgttaatcgaacttgcgatggtcggt
tttatgagtcggcatgaaggacaagcagatactaaactgaatcatatgcagaaagagaga
aaatcatctattctggatagtgaaaaactggatttatattcaaggacgagtttccctctg
gtatatgcaacgtttaacatgatatattggggttattatatgaatggactacttctacaa
taa

KEGG   Loa loa (eye worm): LOAG_16693
Entry
LOAG_16693        CDS       T02664                                 

Name
(RefSeq) gamma-aminobutyric acid receptor subunit beta
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_16693
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:loa04040]
    LOAG_16693
Ion channels [BR:loa04040]
 Ligand-gated channels
  GABA-A
   LOAG_16693
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF1634 PI-PLC-Y
Other DBs
NCBI-GeneID: 31251458
NCBI-ProteinID: XP_020307154
AA seq 478 aa
MGSTIVILLIALFYTMKAFRLLEDEYDPQTRKISEILDVLIDNNTYDRRLRPKHGEEPVN
VGITLHVSSVSAISEVDMDFTIDFYLRQTWNDPRLAFSHYLYGIFENNIDSLTVGVDYLQ
KLWKPDTFFPNEKRSYFHVTTTHNSFLRIYPNGNVFTSQRLTVTAICNMELQLFPMDSQK
CKLEIESYGYSVLDIVYFFNNSKNPVSKSEFELPQFVLIDIQVASRNVALVSGNYSRLTC
TFLFKRNIGFYIIQVYLPSILIVIISWVSFWLNRDATPARVALSVLTILTMTTLTATTNA
SMPKVSYVKSIDIFLGVSFIMVFSSLLEFAAVGYISKRIKLNERKQMDMCRKLPSALSAC
FYTMPSRTEDTIIPLYHPFYSSRDKNSILYNGGAIKPPVILKKGECQCPIPPPSPTSAFH
IKKTPKKEYIILFCVIRPNKIDKYSRFIFPLIFLVFNIIYWFYYYSISGTELTNIDLL
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgggatctaccatagtaatattattgattgctttgttttatacgatgaaagcatttcga
cttcttgaagatgaatatgatccgcagaccagaaaaatctcagaaatattagacgtcctt
atcgataataatacttatgatagacgtctaaggccaaaacatggtgaagaaccggtaaac
gttggtattacgttacatgtgtcaagcgttagtgcaatatccgaagttgatatggacttt
acgatcgatttttatttgaggcaaacttggaatgacccacgccttgcatttagccattac
ctgtatggtatcttcgaaaataacattgattcattaacggttggcgtagattatctacag
aaattatggaaaccagatacatttttcccgaatgagaagaggtcatactttcacgtaact
acaacgcataattcattcttgcgcatctatccaaacggcaacgtatttaccagtcagagg
ctaactgttacagctatatgtaacatggaacttcagttattccctatggattcccagaaa
tgcaaacttgaaattgaaagctatggatacagcgtattagatattgtttactttttcaat
aactcgaaaaatccagtatcgaaatcagaatttgaattgcctcagtttgtactcatcgat
atacaagttgcatcacgaaatgttgccttagtttctggcaactactcacgtctaacctgc
acatttcttttcaagcgaaatataggattctacataattcaagtttatttaccctcaatt
ttgatcgttatcatatcgtgggtatctttctggctcaaccgtgatgcaactccagcacga
gtagcgcttagtgtacttaccatacttactatgactacacttaccgcaactacaaatgcc
tcaatgccgaaagtttcttacgttaaaagcatcgacatatttctcggtgtatcattcatt
atggtattcagttcattacttgaatttgctgccgttggatatatcagtaaaagaataaaa
ttgaacgaaaggaagcaaatggatatgtgtaggaagttaccaagtgcattatcagcctgc
ttctatactatgccatcaagaacagaggacactataattccgctctatcatccattttat
tcatctcgtgataaaaattccattctgtacaatggaggcgcaatcaaaccacctgtaatt
ctgaaaaaaggtgaatgtcaatgtccgatacctccaccatcaccgacatcggcatttcat
ataaagaaaaccccaaaaaaggaatatataatattgttctgtgtcatacgacccaataaa
atcgataaatattcgcgatttatttttcctttgattttcctggtattcaacataatatac
tggttctattactacagcatcagcggtacggagcttacgaatatagacttgctgtga

KEGG   Loa loa (eye worm): LOAG_17503
Entry
LOAG_17503        CDS       T02664                                 

Name
(RefSeq) gamma-aminobutyric acid receptor subunit beta
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_17503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:loa04040]
    LOAG_17503
Ion channels [BR:loa04040]
 Ligand-gated channels
  GABA-A
   LOAG_17503
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 9943665
NCBI-ProteinID: XP_003141833
AA seq 306 aa
MTEWTLKNTINLGYVINALLSDYDNHLLPSNEGVNVTIEMHVQGVTTVSELTGDFELDFM
YSEIWEDPRLNFKQLNVCTTNITLKGEFRKRIWTPETCIINSRHSSIHSSPAENTFILIY
ENGLVWSNFRLKVRAPCKMDLKMFPFDKIHCKLTFESYSYNTDNVRLFWHEKPLTMMEVV
ELPDFELTGWRTNRETLQYPNGEWARATVEFTFARRYGFYLFHSYFPTLLTVISSWVGFF
FDARAASARITLGVSSLLAVTFQFGSVLRHLPRASYIKCSDVWMISSVIFIFCTLVELAV
ISRLNQ
NT seq 921 nt   +upstreamnt  +downstreamnt
atgacagaatggactttgaagaatacaattaatttgggatatgtaatcaacgcattgctc
agtgattatgataatcatttattaccatctaatgaaggtgttaatgttacaattgaaatg
catgtgcagggtgttacaacagtttcggaattaaccggcgattttgaattagattttatg
tatagcgaaatatgggaagatccgcggttaaattttaagcaattaaacgtttgcacaaca
aatattaccttgaaaggtgagtttcggaaaaggatttggacacctgaaacatgtatcatc
aatagcagacattcatcgatacatagttcaccagccgagaatactttcattcttatatat
gaaaatggattggtatggagtaatttcaggcttaaagttagagcgccatgcaaaatggat
ttaaaaatgtttccgtttgataaaatacattgtaagcttacatttgaaagttattcatat
aatacggataatgtacggctattttggcacgaaaaaccattaacaatgatggaagtagtt
gaattaccggatttcgaattaactggttggagaacaaatcgtgaaacattgcaatatccg
aatggcgaatgggctagagcaacggttgaatttacatttgcccgacgatatggtttctat
ctctttcattcctactttccaacattactgacagttattagttcttgggttggattcttc
tttgatgcacgagctgcttctgcaaggataacattgggtgtatcatcattattagcagta
acttttcaatttggtagtgttttacgtcatctaccacgtgctagttatattaaatgttcg
gatgtatggatgatcagttcggttattttcattttctgtacacttgttgaattagctgtt
atttctcggcttaatcagtaa

DBGET integrated database retrieval system