KEGG   Loa loa (eye worm): LOAG_01694
Entry
LOAG_01694        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12593  M-phase phosphoprotein 6, animal type
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_01694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_01694
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     LOAG_01694
SSDB
Motif
Pfam: MPP6 Utp14
Other DBs
NCBI-GeneID: 9939070
NCBI-ProteinID: XP_020303768
AA seq 175 aa
MSDHTDTKGLSSALLQMKFMQRTRIRLEEEAKRKSEQKLQKRFLKKDNKELSEELEGTEP
TVKSENRYDLLENLSFGRMSFKGFNPEVEKLMKYYKDLKGGKVSDEVDFNDGQDITDYEL
ATSVFSTKTKGDGKCLKKHEMDGRSLIDEINEPAKRKRRDDGHRPESGIRKRQQL
NT seq 528 nt   +upstreamnt  +downstreamnt
atgagtgaccacaccgatactaaaggattgtcttcggcgcttctgcaaatgaagtttatg
caaaggacaagaattcgcttagaggaagaagctaagagaaaaagtgaacagaaattgcag
aaacgttttttaaaaaaggataataaagaactatcggaagagttagaaggaacagaacca
accgtgaaatctgaaaacagatatgacttgttggaaaacctttcatttggacggatgtct
tttaaaggtttcaatccggaagttgagaagcttatgaaatattataaagatttgaaaggt
ggcaaagtgtctgatgaagtcgactttaatgatggacaggatattacggattacgaatta
gcaacatcagtgttcagcacaaaaacaaaaggagatggaaaatgtctaaagaagcatgaa
atggatggaagaagtttaattgatgaaattaacgaacccgcaaagcggaaacggcgagac
gatggacatcgacctgaatctggaatccgaaaaagacagcagttatga

DBGET integrated database retrieval system