KEGG   Loa loa (eye worm): LOAG_01974
Entry
LOAG_01974        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04145  dopamine receptor D2
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_01974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_01974
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    LOAG_01974
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 9939362
NCBI-ProteinID: XP_003137560
UniProt: A0A1S0U9P4
AA seq 249 aa
MNISSCIMDSTTLQCSPKLAIPDHELNISGLFFLIIPTITVLGNSMVIIAVLRFKTLHSA
INFLIFGLAVADLLVGLFVMPYAVYVHVQGGYWFLGSMMCDIYSAIDVACSTASILILTV
ISFDRYRAVTHPISYSHKSHDTKRVIFIMAVIWVISLTLASPMVLGVNIRPPDVDPYECR
FYNPIFSISSSIISFVIPCFIVLFVYIRIMIALRQRQNLSKKQHWSYLRPLKRLNSTLVQ
NCFRKRLGH
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaatataagcagctgcattatggactcaacaactttgcaatgctcgccgaagttagct
attccggaccatgaacttaatatttccggattattctttttaattattccaaccattact
gttctgggtaattctatggtaattattgctgtactacgctttaaaactcttcattcagct
attaatttcctaatctttggcttggctgttgctgatctcctagttggactttttgtcatg
ccctatgccgtttatgtccatgtgcaaggtggttattggttcctcgggtcgatgatgtgt
gatatatattcagcaattgatgtcgcctgcagtactgcgtccatacttattctaacagtc
attagttttgataggtatcgagctgtcacccatcctataagttattcacacaaatctcat
gatacaaaacgggttatttttattatggccgtcatttgggtcatttcacttacacttgct
agtccaatggtacttggtgtgaatatccgaccaccggatgtggatccgtacgaatgtcgt
ttctataatccaatattttcaatatcttcatcaattattagttttgtcataccctgtttt
attgttttattcgtttatattaggataatgattgctttgcgccaaaggcaaaatttatcc
aaaaaacagcattggtcatatttacggccgttaaaaaggttaaattcaacactggttcag
aactgcttccgaaaaagacttgggcattga

KEGG   Loa loa (eye worm): LOAG_01975
Entry
LOAG_01975        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04145  dopamine receptor D2
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_01975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_01975
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    LOAG_01975
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF4798
Other DBs
NCBI-GeneID: 9939361
NCBI-ProteinID: XP_003137561
UniProt: A0A1S0U8H3
AA seq 453 aa
MISEVFSVETAEITRPQLTIDSDMNKLNMGKGRKMKLNDTLATVSKITTLYSRKIDKGNS
KNGVQRSRKQYDGCGVYMNRIVNDSAEMIKINDTDISDEEVSSKARKSFSEEFLVRMLEK
LNCNSLPCPCRQVTLSRFLQNDSRSKENSVIFVPQLEVYKFYELQDMSTSGKKREKDVLC
DEKSETDLAAFSDKLVLQDEMDKRSDREQHLFINANAEEYTEAAEQQGKGKTQLELDTDL
VAKKLLDNRSISEGNDTEIKQYGRQQKDLERSEKTEWRETEGIREESDSLDERVRKTLRK
CCILSSFRKKYKKTNLPHLSSIDSKNSFLTERTSTIFRRPLNRSSSLTGRHCNRTQRMEK
RATKTLGIVVGIFLACWVPFFSVYILNAVCIQLDIKSCQVDFYAFFYTTWLGYINSCINP
IIYTIFNVEFRRAFKCILFGKVRSFIHSLFPLT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgatatcggaagttttttcagtagaaacagcagaaataacgagaccacagctaacaatc
gattctgatatgaataaattaaatatgggcaaaggaaggaagatgaaactgaatgacact
cttgccacggtttcaaagataactacactttattctcgtaaaattgataaaggaaattcc
aaaaatggagtgcaaaggtcacgcaagcaatacgacggctgcggagtgtatatgaataga
attgtgaatgatagcgctgaaatgatcaaaatcaatgatactgatatttctgacgaagag
gtttctagtaaagcaagaaaatcgttcagtgaagaattcctggtgcgaatgttggaaaaa
ttaaattgtaacagtttgccttgtccctgcagacaagttactttaagtcggttcctacag
aatgattccagaagcaaagaaaattcagtgatatttgtgccgcaactagaagtttataag
ttttatgaattacaggacatgagtacttccgggaaaaaacgagaaaaagatgttctctgt
gatgagaaatcggagactgatctggctgctttcagcgataaacttgtattgcaagatgaa
atggacaaaaggagtgatagagaacaacatctattcatcaatgctaatgcagaggaatat
acagaagctgctgaacagcaaggaaaaggaaagacgcagttggaacttgacactgacctt
gttgctaagaaacttttagacaatagatcaatatccgaaggaaacgatactgaaataaag
caatatggtagacagcaaaaggatcttgaaagaagtgaaaagactgaatggcgagaaacg
gaaggtattagagaggagtctgatagtcttgatgaaagagtcagaaaaactttgagaaaa
tgctgtattttgtcgagttttcggaagaaatataagaaaacaaaccttccacacttgagt
tcaattgattccaaaaacagctttctaacagaacggacctcaacgatattcagaagacca
ttaaatcgtagtagtagcttgactggaaggcattgcaacagaactcaacggatggagaaa
cgagcgacgaagacgcttggtattgttgtcgggatatttctggcttgctgggtgccattt
ttttcggtatatatcctcaatgcggtatgtattcagttggatattaagagctgccaagtt
gatttttatgcctttttctatacaacatggcttggctatatcaactcatgtatcaaccca
attatttacactattttcaacgtggaatttcgacgtgccttcaaatgtatattatttggg
aaagttcgttcattcattcattcattatttcctcttacttag

KEGG   Loa loa (eye worm): LOAG_06589
Entry
LOAG_06589        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04144  dopamine receptor D1
Organism
loa  Loa loa (eye worm)
Pathway
loa04020  Calcium signaling pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    LOAG_06589
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_06589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_06589
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    LOAG_06589
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx DUF6328
Other DBs
NCBI-GeneID: 9944003
NCBI-ProteinID: XP_020302561
AA seq 290 aa
MLSAASILLIVYSVIILVALGGNLLVCVAVFYDRILRRQQENLFLVSLAVSDLLISLLVM
SFAASNDILGYWPFGRLYCQLWICFDITCTTASILNLSAIALHRFLHISRPLVYVRCFRR
RKICIVIAFVWLISAIIGSTQIILELVQRDEGIDDRNEVDETKYNNSHPRCELRLKPFYA
LGSSMCSFVIPAAMMVLLYTRLYLFARKHAKIMRIQVQQAANFAVTLNACEGIRNNTNVG
FFYDRIFAMCRCCHRNDPIVLERIKSKNVSSKLCITDQKARSNLILEMKI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgctctcagctgcaagtattttgttaattgtttattctgttattatattggttgcattg
ggtggtaatttgttggtatgtgttgctgtattctatgatcgaattttacgacgacagcag
gagaatttatttttggtatcacttgctgtatctgatcttcttatatcattgcttgtgatg
tcattcgcagcatctaatgatattctcggatattggccatttggtcgcttgtactgccaa
ctttggatatgtttcgatattacatgtaccacagcttcaatactcaacctatctgcaatt
gccttacacagatttttgcatatcagtcgtccactcgtttatgtcaggtgcttcaggagg
cgaaaaatatgcatcgttatagcatttgtttggctgatatctgctatcattggttccacg
caaattatcctggaattagtacagagggatgaaggaattgatgataggaatgaagttgat
gagactaaatacaataattctcatccaagatgtgagctacgacttaaaccattttatgca
ttaggcagttctatgtgcagttttgttatacctgcggcaatgatggtacttctgtacact
cgtctctatctattcgccaggaaacatgctaaaataatgcgtatccaagttcagcaagca
gctaactttgctgtaacactgaatgcttgtgaaggaattcgaaataatactaatgttgga
tttttttatgatagaatatttgcaatgtgccgttgttgtcacaggaatgatcctattgta
ttggaacgaatcaagtcgaaaaatgtctcatcaaaactctgtatcactgatcagaaagct
aggtcaaacttgattcttgaaatgaagatttga

DBGET integrated database retrieval system