KEGG   Loa loa (eye worm): LOAG_02001
Entry
LOAG_02001        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K07573  exosome complex component CSL4
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_02001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_02001
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_02001
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Core exosome
     LOAG_02001
SSDB
Motif
Pfam: ECR1_N EXOSC1
Other DBs
NCBI-GeneID: 9939380
NCBI-ProteinID: XP_003137587
UniProt: A0A1I7VNV7
AA seq 215 aa
MNASSSDSSNNTCFIGEGCSKYVIPGDRLFPISEQLKAGIGTYELFGHIYASLAGTLHMY
TTVERDKETKIVEVRRESEKEKRHIMPYVGCIVTAKVQNIGQRFAKCAIHCVECSVLSHE
FNGILRKEDIMPIEKEKIKLEQCVHPGDVILARVIGFGDNQHSYLLSTVEDELGVVSGIG
DFGGRMVPCSFSEVKSVVTGTREPRKVAHIPDLNR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaatgccagcagcagtgacagcagcaacaatacatgcttcataggcgaaggatgcagc
aagtatgtgataccaggtgatcgactgtttcccattagtgaacagctgaaagcaggcatc
ggtacttacgaattgttcgggcatatttatgcatcattagctggtaccctacacatgtat
acaactgtcgagcgtgacaaagaaacgaaaatcgtagaagtacgacgagaatcggaaaaa
gagaaacgacatatcatgccatatgttggatgcattgtaactgcaaaggtgcaaaacatt
ggtcagagatttgccaaatgcgcaatacattgcgtggaatgttccgttttatctcacgaa
tttaatggaatattgaggaaagaagatataatgcccatcgagaaagagaaaataaaacta
gagcaatgtgtgcatcctggtgatgtcatcttagcacgtgttattggttttggtgataat
cagcattcatatttgcttagtaccgtagaagatgaattgggtgttgtaagcggtattggt
gattttggtggacggatggtaccatgttcttttagtgaagtaaaatcagttgtgacaggt
acgcgcgaacctagaaaagtagcgcatatacctgatttaaatcgttga

DBGET integrated database retrieval system