KEGG   Loa loa (eye worm): LOAG_02698
Entry
LOAG_02698        CDS       T02664                                 

Name
(RefSeq) ATP-dependent RNA helicase cgh-1
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_02698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_02698
   03036 Chromosome and associated proteins [BR:loa03036]
    LOAG_02698
Enzymes [BR:loa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     LOAG_02698
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LOAG_02698
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     LOAG_02698
Chromosome and associated proteins [BR:loa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    LOAG_02698
SSDB
Motif
Pfam: DEAD Helicase_C
Other DBs
NCBI-GeneID: 9940081
NCBI-ProteinID: XP_020303523
AA seq 432 aa
MTSKTESQSDQSWKENLNLPAKDLRFKTTDVTDTKGIEFEDFCLKRPLLMGIFEKGWEKP
SPIQEASISIALSGQDILARAKNGTGKTGAYCIPCIDKVDVEKKYPQSLIIVPTRELAFQ
TSNICVDLSKHMNLKVMVTTGGTELRNDIMRLNGTVHIIVATPGRILDLMDKNVADMSHC
TTLVLDEADKLLSQDFQGILDRVIKFLPPDRQIMLYSATFPLTVATFMQKHMRNPYEINL
MEELTLVGVTQYYAYVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYS
CYYIHSRMAQGHRNRVFHDFRKGACRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLH
RIGRSGRFGHLGIAINLITYEDRFTLRRIEAELRTRIAPIPKSVDPKLYVAEYQIVDENG
SEMVGSSKETAA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaccagcaaaacggagtcacagagtgatcagtcttggaaggaaaaccttaatttgccg
gctaaagatctgcgcttcaagacaacggatgtgacggatacaaaaggtattgaatttgag
gatttttgcttgaagcgaccgttattgatggggatttttgagaaaggttgggaaaagcca
agtccgatacaggaagcatccatttcaattgctttatcaggtcaagatatattagcacgc
gcaaagaacggtacaggtaaaacaggtgcctactgtatcccttgtattgacaaagtcgat
gtcgaaaagaaatatccgcaatcattgatcattgtaccaacgagggaactagcattccaa
acctctaatatttgtgtcgacttgagcaaacacatgaatttgaaggtaatggttactacg
ggaggtacggaacttcgtaacgatatcatgcgtctgaatggtactgttcatattattgtg
gcaactcctggccgtattcttgatcttatggataagaatgttgctgatatgtcgcactgc
acaacgctggtattggatgaagctgataaactgctttctcaggatttccaaggcatttta
gatcgtgtcatcaaatttctaccgcccgatcgacaaattatgctctattcggcaacattt
ccactgacagtggcaacattcatgcagaagcacatgagaaacccatatgaaattaatctg
atggaagaattgacactggtcggtgttacgcagtattatgcctatgtgcaagaaaagcag
aaagtgcattgcttgaacacgttgttccgcaagcttcaaatcaaccagtccataattttt
tgtaattcaacgcaacgtgtggaacttttggcaaagaaaatcacagaaataggctattcc
tgctattacatccattcacgtatggcacagggtcatcgtaatcgagtttttcacgatttt
cgtaaaggagcttgtcgtaatttggtctgctctgatttgcttactagaggtatcgatatt
caggccgtaaatgtagtcatcaattttgatttcccgcgcaatgccgaaacatacttgcat
cgtattggacgttcgggtcgcttcggacatctcggtattgcgatcaaccttatcacttac
gaagatcgctttactcttcgacgtattgaagctgagctaaggactcgcattgctccaatt
ccaaagtcggtggatccgaaactctacgttgccgaatatcagatcgttgatgagaatggt
agcgaaatggttggatcttccaaggaaacggctgcctag

DBGET integrated database retrieval system