KEGG   Loa loa (eye worm): LOAG_03684
Entry
LOAG_03684        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12590  exosome complex component RRP46
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_03684
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_03684
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_03684
SSDB
Motif
Pfam: RNase_PH
Other DBs
NCBI-GeneID: 9941073
NCBI-ProteinID: XP_003139269
UniProt: A0A1I7VKX0
AA seq 224 aa
MELRPVEVSDNSRQKLRDLKAQLSFLPRADGSCALEQGTTVIWCGINGPGNVSSSKRLSE
RLVIDILYKHAHGLKNSVKINRLLGAALKHSVDHVHYPRVVLNVTLHLLQEGGCEAAAAL
NAACLAALDLGIIMNGMFCGITVATSQGNLILDPICPQCCSADAVYTFAFYSSGKESTKT
VACDTDGTFEYGTFEAARTLAKQASADIFLFYREILQRKLSVDI
NT seq 675 nt   +upstreamnt  +downstreamnt
atggaattgagacctgttgaagtatccgataattctcgtcaaaagctacgcgatcttaaa
gcacagctaagttttctgccccgagctgatggctcctgtgctttggaacaaggtaccact
gtgatatggtgcggaatcaatggtcctggtaatgtctcttcctcgaaacgactcagtgaa
cgactcgtcattgatattctttataagcatgctcatgggctaaagaattctgttaagatt
aatcgattattgggtgctgcgttgaaacacagcgttgaccatgttcattatcctcgtgtt
gttctgaatgtcaccctgcatttattacaggaaggtggctgtgaggcagctgcagctcta
aatgccgcttgtttggcagctcttgacttaggcattattatgaatggaatgttttgtgga
attactgtagcaacttctcaaggaaatctcatcttggacccaatctgtccacagtgctgt
tctgcagatgcagtctacacatttgcattttattcgagtggcaaagaatcgacgaaaacg
gtggcttgcgatacagatggaacattcgagtatggtacatttgaagctgcaagaacactg
gctaagcaagcatctgctgatattttcttattttaccgagaaattttgcaaagaaaactt
agcgtcgacatttag

DBGET integrated database retrieval system