KEGG   Loa loa (eye worm): LOAG_04270
Entry
LOAG_04270        CDS       T02664                                 

Name
(RefSeq) CCR4-NOT transcription complex subunit 7
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_04270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_04270
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_04270
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_04270
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 9941669
NCBI-ProteinID: XP_003139855
UniProt: A0A1I7VI76
AA seq 293 aa
MNDPEVKIHDVWANNLEEEFKRIRDTVKDYPFVAMDTEFPGVVATPLGQFKSKEDFNYQQ
VSCNVNMLKLIQVGFALLDKEGNMPSTGDVWQFNFQFSLNDDMYSQDSVDLLRNAGIDFG
RHQIEGIRMADFGELLTTSGLIVDEHITWLTFHSGYDFGYLMRSILLSELPKEESQFFQY
HRKLFPCSYDLKMLLKHPGLVNAKLRGGLQELADQLKVIRKGQQHQAGSDSLLTAQTFFK
IKERFFEGTWDQVAPTVEGHLYGLGNTLSSSAPFVQIDSSTPEPQQSSTPEAP
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaacgatcccgaagtgaagatccacgatgtttgggcgaacaacctggaggaagagttc
aaacgaatacgggatacagtcaaagattacccatttgttgcaatggatacggaatttcct
ggtgtagttgctacacctttgggtcaattcaaaagtaaagaggatttcaactatcaacag
gtttcctgcaatgtaaatatgttaaaacttatccaggttggattcgctttgttggataaa
gaaggtaatatgccatcgacgggtgatgtatggcagtttaactttcagttttccttaaat
gacgatatgtattcgcaagatagtgtcgatttattacgtaatgctggcatagattttgga
cgacaccagattgaaggaatacggatggcagattttggtgaactacttacgacatcaggt
ttaattgttgatgaacatatcacctggttaacatttcatagtggttatgatttcggatat
ctcatgcgttctattctgctttcggaattacccaaagaagaatcacagttctttcaatat
caccgaaaactttttccatgtagttatgatctaaaaatgctattaaagcacccaggtttg
gtgaatgcaaaactgagaggcggtttacaagagcttgctgatcagctaaaagtaattcga
aaaggacagcaacatcaagcaggttctgactcattactcactgcacaaacattcttcaaa
attaaagagcggttttttgagggtacttgggatcaggtcgcgccaacagtcgaaggacat
ttgtatggtctcgggaatacgctctcatccagtgcaccatttgtgcagatagactcatca
acccccgaaccacaacaatcgtcgacaccagaagcaccatga

DBGET integrated database retrieval system